BLASTX nr result
ID: Rehmannia28_contig00027740
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00027740 (671 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012846758.1| PREDICTED: uncharacterized protein LOC105966... 56 3e-06 >ref|XP_012846758.1| PREDICTED: uncharacterized protein LOC105966719 [Erythranthe guttata] gi|604317761|gb|EYU29582.1| hypothetical protein MIMGU_mgv1a014125mg [Erythranthe guttata] Length = 200 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/40 (62%), Positives = 33/40 (82%), Gaps = 3/40 (7%) Frame = +2 Query: 443 ENPRSTHTQPFVAM---NASSRASWMDCCGLLDVLRPSDQ 553 ENPR+TH QP A+ +A+S ASWM+CCGLL++LRPSD+ Sbjct: 161 ENPRATHGQPLAAVAATSATSPASWMNCCGLLELLRPSDK 200