BLASTX nr result
ID: Rehmannia28_contig00027518
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00027518 (548 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076177.1| PREDICTED: 25.3 kDa vesicle transport protei... 74 5e-13 >ref|XP_011076177.1| PREDICTED: 25.3 kDa vesicle transport protein isoform X1 [Sesamum indicum] Length = 223 Score = 73.9 bits (180), Expect = 5e-13 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -3 Query: 546 SPIWCSKRLEIIAPKWIPIGLVLAVMTILVWTSLHREDSLSTGF 415 SPIWCSKRLEIIA KWIP+GLVLAV TIL+WTSL ++D L GF Sbjct: 180 SPIWCSKRLEIIALKWIPVGLVLAVTTILIWTSLLKDDLLFPGF 223