BLASTX nr result
ID: Rehmannia28_contig00027321
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00027321 (362 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009764368.1| PREDICTED: cysteine-rich and transmembrane d... 82 2e-18 ref|XP_009600875.1| PREDICTED: cysteine-rich and transmembrane d... 78 4e-17 ref|XP_015165117.1| PREDICTED: cysteine-rich and transmembrane d... 78 6e-17 ref|XP_006421267.1| hypothetical protein CICLE_v10006402mg [Citr... 74 1e-15 gb|EEF30889.1| conserved hypothetical protein [Ricinus communis] 72 1e-14 gb|KJB35914.1| hypothetical protein B456_006G133500 [Gossypium r... 71 3e-14 ref|XP_002308904.2| hypothetical protein POPTR_0006s04180g [Popu... 71 8e-14 ref|XP_009349066.1| PREDICTED: cysteine-rich and transmembrane d... 70 9e-14 emb|CBI30080.3| unnamed protein product [Vitis vinifera] 69 2e-13 gb|KFK24859.1| hypothetical protein AALP_AA8G034200 [Arabis alpina] 66 4e-12 ref|XP_011467336.1| PREDICTED: cysteine-rich and transmembrane d... 65 4e-12 ref|XP_010543520.1| PREDICTED: cysteine-rich and transmembrane d... 65 5e-12 ref|NP_196028.2| uncharacterized protein [Arabidopsis thaliana] ... 65 6e-12 ref|XP_006398865.1| hypothetical protein EUTSA_v10015225mg [Eutr... 64 1e-11 ref|XP_006398866.1| hypothetical protein EUTSA_v10015225mg [Eutr... 64 1e-11 ref|XP_002871075.1| hypothetical protein ARALYDRAFT_908293 [Arab... 64 1e-11 ref|XP_008359585.1| PREDICTED: CYSTM1 family protein A-like [Mal... 64 2e-11 ref|XP_013612366.1| PREDICTED: cysteine-rich and transmembrane d... 64 3e-11 emb|CDX70261.1| BnaA10g26100D [Brassica napus] 64 3e-11 ref|XP_013668202.1| PREDICTED: cysteine-rich and transmembrane d... 64 3e-11 >ref|XP_009764368.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Nicotiana sylvestris] Length = 62 Score = 81.6 bits (200), Expect = 2e-18 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 225 KKMKCLPRTKAKGERGFLEGCLFALCCCWLCEVCFD 332 KKMKC PR+K KGERGFLEGCLFALCCCW+CEVCFD Sbjct: 27 KKMKCFPRSKPKGERGFLEGCLFALCCCWICEVCFD 62 >ref|XP_009600875.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Nicotiana tomentosiformis] Length = 61 Score = 78.2 bits (191), Expect = 4e-17 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 225 KKMKCLPRTKAKGERGFLEGCLFALCCCWLCEVCF 329 KKMKC P++K KGERGFLEGCLFALCCCW+CEVCF Sbjct: 27 KKMKCFPKSKPKGERGFLEGCLFALCCCWICEVCF 61 >ref|XP_015165117.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Solanum tuberosum] Length = 62 Score = 77.8 bits (190), Expect = 6e-17 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +3 Query: 222 KKKMKCLPRTKAKGERGFLEGCLFALCCCWLCEVCFD 332 KKKMK PR+K +GERGFLEGCLFALCCCWLCEVCFD Sbjct: 26 KKKMKGWPRSKPRGERGFLEGCLFALCCCWLCEVCFD 62 >ref|XP_006421267.1| hypothetical protein CICLE_v10006402mg [Citrus clementina] gi|557523140|gb|ESR34507.1| hypothetical protein CICLE_v10006402mg [Citrus clementina] Length = 60 Score = 74.3 bits (181), Expect = 1e-15 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +3 Query: 219 GKKKMKCLPRTKAKGERGFLEGCLFALCCCWLCEVCF 329 GK K KCL +TK KG+RGF+EGCLFALCCCWLCE CF Sbjct: 24 GKGKKKCLSQTKKKGDRGFIEGCLFALCCCWLCEACF 60 >gb|EEF30889.1| conserved hypothetical protein [Ricinus communis] Length = 56 Score = 71.6 bits (174), Expect = 1e-14 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 228 KMKCLPRTKAKGERGFLEGCLFALCCCWLCEVCF 329 K KC P TK KG+RGF+EGCLFALCCCWLCE CF Sbjct: 23 KKKCCPNTKKKGDRGFIEGCLFALCCCWLCEACF 56 >gb|KJB35914.1| hypothetical protein B456_006G133500 [Gossypium raimondii] Length = 60 Score = 70.9 bits (172), Expect = 3e-14 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 234 KCLPRTKAKGERGFLEGCLFALCCCWLCEVCF 329 KC PR+K KG+RGF+EGCLFALCCCWLCE CF Sbjct: 29 KCFPRSKKKGDRGFIEGCLFALCCCWLCETCF 60 >ref|XP_002308904.2| hypothetical protein POPTR_0006s04180g [Populus trichocarpa] gi|550335432|gb|EEE92427.2| hypothetical protein POPTR_0006s04180g [Populus trichocarpa] Length = 94 Score = 70.9 bits (172), Expect = 8e-14 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 234 KCLPRTKAKGERGFLEGCLFALCCCWLCEVC 326 KC PRTK KGERGF+EGCLFALCCCW+CE+C Sbjct: 63 KCFPRTKKKGERGFIEGCLFALCCCWICEMC 93 >ref|XP_009349066.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Pyrus x bretschneideri] Length = 61 Score = 69.7 bits (169), Expect = 9e-14 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 234 KCLPRTKAKGERGFLEGCLFALCCCWLCEVCF 329 K PRTKAKGERGF+EGCLFALCCCWLCE CF Sbjct: 30 KFRPRTKAKGERGFIEGCLFALCCCWLCEECF 61 >emb|CBI30080.3| unnamed protein product [Vitis vinifera] Length = 56 Score = 68.6 bits (166), Expect = 2e-13 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 237 CLPRTKAKGERGFLEGCLFALCCCWLCEVCF 329 C PR+K+KG+RGF+EGCLFALCCCW+CE CF Sbjct: 26 CCPRSKSKGDRGFIEGCLFALCCCWICEACF 56 >gb|KFK24859.1| hypothetical protein AALP_AA8G034200 [Arabis alpina] Length = 67 Score = 65.9 bits (159), Expect = 4e-12 Identities = 27/40 (67%), Positives = 33/40 (82%), Gaps = 3/40 (7%) Frame = +3 Query: 219 GKKKMKCLPR---TKAKGERGFLEGCLFALCCCWLCEVCF 329 G++K K PR TK KG+RGF+EGCLFALCCCW+CE+CF Sbjct: 28 GQEKKKKKPRFFETKEKGDRGFIEGCLFALCCCWICEMCF 67 >ref|XP_011467336.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Fragaria vesca subsp. vesca] Length = 59 Score = 65.5 bits (158), Expect = 4e-12 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 228 KMKCLPRTKAKGERGFLEGCLFALCCCWLCEVCF 329 + K P+TK KG+RGF+EGCLFALCCCWLCE CF Sbjct: 26 RKKFRPQTKKKGDRGFIEGCLFALCCCWLCEECF 59 >ref|XP_010543520.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Tarenaya hassleriana] Length = 65 Score = 65.5 bits (158), Expect = 5e-12 Identities = 27/37 (72%), Positives = 31/37 (83%), Gaps = 2/37 (5%) Frame = +3 Query: 222 KKKMKCLPR--TKAKGERGFLEGCLFALCCCWLCEVC 326 KKK K LP TK KG+RGF+EGCLFALCCCW+CE+C Sbjct: 28 KKKKKLLPSFGTKQKGDRGFIEGCLFALCCCWICEMC 64 >ref|NP_196028.2| uncharacterized protein [Arabidopsis thaliana] gi|38603900|gb|AAR24695.1| At5g04080 [Arabidopsis thaliana] gi|41349906|gb|AAS00338.1| At5g04080 [Arabidopsis thaliana] gi|332003311|gb|AED90694.1| uncharacterized protein AT5G04080 [Arabidopsis thaliana] Length = 63 Score = 65.1 bits (157), Expect = 6e-12 Identities = 27/40 (67%), Positives = 32/40 (80%), Gaps = 3/40 (7%) Frame = +3 Query: 219 GKKKMKCLPR---TKAKGERGFLEGCLFALCCCWLCEVCF 329 G+ K K PR TK KG+RGF+EGCLFALCCCW+CE+CF Sbjct: 24 GQDKKKKKPRFFETKQKGDRGFIEGCLFALCCCWICEMCF 63 >ref|XP_006398865.1| hypothetical protein EUTSA_v10015225mg [Eutrema salsugineum] gi|557099955|gb|ESQ40318.1| hypothetical protein EUTSA_v10015225mg [Eutrema salsugineum] Length = 59 Score = 64.3 bits (155), Expect = 1e-11 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = +3 Query: 219 GKKKMKCLPRTKAKGERGFLEGCLFALCCCWLCEVCF 329 G+ + K + +TK KG+RGF+EGCLFALCCCW+CE+CF Sbjct: 23 GQDEKKKVFKTKQKGDRGFIEGCLFALCCCWVCEMCF 59 >ref|XP_006398866.1| hypothetical protein EUTSA_v10015225mg [Eutrema salsugineum] gi|557099956|gb|ESQ40319.1| hypothetical protein EUTSA_v10015225mg [Eutrema salsugineum] Length = 64 Score = 64.3 bits (155), Expect = 1e-11 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = +3 Query: 219 GKKKMKCLPRTKAKGERGFLEGCLFALCCCWLCEVCF 329 G+ + K + +TK KG+RGF+EGCLFALCCCW+CE+CF Sbjct: 28 GQDEKKKVFKTKQKGDRGFIEGCLFALCCCWVCEMCF 64 >ref|XP_002871075.1| hypothetical protein ARALYDRAFT_908293 [Arabidopsis lyrata subsp. lyrata] gi|297316912|gb|EFH47334.1| hypothetical protein ARALYDRAFT_908293 [Arabidopsis lyrata subsp. lyrata] Length = 64 Score = 64.3 bits (155), Expect = 1e-11 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 222 KKKMKCLPRTKAKGERGFLEGCLFALCCCWLCEVCF 329 KKK TK KG+RGF+EGCLFALCCCW+CE+CF Sbjct: 29 KKKKPRFFETKKKGDRGFIEGCLFALCCCWICEMCF 64 >ref|XP_008359585.1| PREDICTED: CYSTM1 family protein A-like [Malus domestica] Length = 58 Score = 63.5 bits (153), Expect = 2e-11 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +3 Query: 234 KCLPRTKAKGERGFLEGCLFALCCCWLCEVCF 329 K P TK KG+RGF+EGCLFALCCCWLCE CF Sbjct: 27 KFRPWTKKKGDRGFIEGCLFALCCCWLCEECF 58 >ref|XP_013612366.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Brassica oleracea var. oleracea] Length = 65 Score = 63.5 bits (153), Expect = 3e-11 Identities = 26/38 (68%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = +3 Query: 219 GKKKMKCLP-RTKAKGERGFLEGCLFALCCCWLCEVCF 329 G+ K K P TK KG+RGF+EGCLFALCCCW+CE+CF Sbjct: 28 GQDKNKKKPFETKQKGDRGFIEGCLFALCCCWICEMCF 65 >emb|CDX70261.1| BnaA10g26100D [Brassica napus] Length = 65 Score = 63.5 bits (153), Expect = 3e-11 Identities = 26/38 (68%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = +3 Query: 219 GKKKMKCLP-RTKAKGERGFLEGCLFALCCCWLCEVCF 329 G+ K K P TK KG+RGF+EGCLFALCCCW+CE+CF Sbjct: 28 GQDKNKKKPFETKQKGDRGFIEGCLFALCCCWICEMCF 65 >ref|XP_013668202.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Brassica napus] gi|674891345|emb|CDY41401.1| BnaCnng10370D [Brassica napus] Length = 65 Score = 63.5 bits (153), Expect = 3e-11 Identities = 26/38 (68%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = +3 Query: 219 GKKKMKCLP-RTKAKGERGFLEGCLFALCCCWLCEVCF 329 G+ K K P TK KG+RGF+EGCLFALCCCW+CE+CF Sbjct: 28 GQDKNKKKPFETKQKGDRGFIEGCLFALCCCWICEMCF 65