BLASTX nr result
ID: Rehmannia28_contig00025974
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00025974 (328 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008457427.1| PREDICTED: copper transporter 1 [Cucumis melo] 74 2e-14 ref|XP_004145275.1| PREDICTED: copper transporter 1-like [Cucumi... 73 3e-14 gb|EYU38447.1| hypothetical protein MIMGU_mgv1a023401mg, partial... 72 4e-14 gb|EYU35135.1| hypothetical protein MIMGU_mgv1a024007mg, partial... 71 5e-14 ref|XP_012840081.1| PREDICTED: copper transporter 1-like, partia... 71 7e-14 ref|XP_012835839.1| PREDICTED: copper transporter 6 [Erythranthe... 72 8e-14 ref|XP_011035246.1| PREDICTED: copper transporter 1-like [Populu... 72 1e-13 ref|XP_002298334.2| hypothetical protein POPTR_0001s25290g [Popu... 71 3e-13 ref|XP_008384899.1| PREDICTED: copper transporter 1-like [Malus ... 70 4e-13 ref|XP_002313412.1| copper transporter family protein [Populus t... 70 5e-13 ref|XP_004309719.1| PREDICTED: copper transporter 1-like [Fragar... 70 5e-13 ref|XP_008355761.1| PREDICTED: copper transporter 6-like [Malus ... 70 5e-13 ref|XP_006424958.1| hypothetical protein CICLE_v10029475mg [Citr... 69 6e-13 ref|XP_009785614.1| PREDICTED: copper transporter 6-like [Nicoti... 70 7e-13 ref|XP_015886064.1| PREDICTED: copper transporter 1-like [Ziziph... 70 7e-13 ref|XP_011032214.1| PREDICTED: copper transporter 6-like [Populu... 69 1e-12 ref|XP_006424959.1| hypothetical protein CICLE_v10029475mg [Citr... 69 1e-12 ref|XP_002313411.1| Copper transporter 1 family protein [Populus... 69 2e-12 emb|CDP09123.1| unnamed protein product [Coffea canephora] 68 2e-12 ref|XP_008349588.1| PREDICTED: copper transporter 1-like [Malus ... 68 2e-12 >ref|XP_008457427.1| PREDICTED: copper transporter 1 [Cucumis melo] Length = 153 Score = 73.6 bits (179), Expect = 2e-14 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -2 Query: 327 AVATEWFSHCNVLRETSSPAAARLVRTLMYAVRIGLAYLVMLAVMSFNAGV 175 A EW +HC +++E SS AAA L+RTLM+ VR+GLAYLVMLAVMSFN GV Sbjct: 71 AFLVEWLTHCRLIKEDSSQAAAGLIRTLMHTVRVGLAYLVMLAVMSFNVGV 121 >ref|XP_004145275.1| PREDICTED: copper transporter 1-like [Cucumis sativus] gi|700210667|gb|KGN65763.1| hypothetical protein Csa_1G526830 [Cucumis sativus] Length = 153 Score = 73.2 bits (178), Expect = 3e-14 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -2 Query: 327 AVATEWFSHCNVLRETSSPAAARLVRTLMYAVRIGLAYLVMLAVMSFNAGV 175 A EW +HC +++E SS AAA L+RTLM+ VR+GLAYLVMLAVMSFN GV Sbjct: 71 AFLVEWLTHCRLIKEDSSRAAAGLIRTLMHTVRVGLAYLVMLAVMSFNVGV 121 >gb|EYU38447.1| hypothetical protein MIMGU_mgv1a023401mg, partial [Erythranthe guttata] Length = 140 Score = 72.4 bits (176), Expect = 4e-14 Identities = 39/59 (66%), Positives = 47/59 (79%), Gaps = 7/59 (11%) Frame = -2 Query: 327 AVATEWFSHCNVLR-ETSSP------AAARLVRTLMYAVRIGLAYLVMLAVMSFNAGVF 172 A+A EW SHCN+LR ET+S AA +++T++YAVRIGLAYLVMLAVMSFNAGVF Sbjct: 75 ALAVEWLSHCNILRPETASSRRGSAAAAIGVMQTVLYAVRIGLAYLVMLAVMSFNAGVF 133 >gb|EYU35135.1| hypothetical protein MIMGU_mgv1a024007mg, partial [Erythranthe guttata] Length = 102 Score = 71.2 bits (173), Expect = 5e-14 Identities = 38/58 (65%), Positives = 46/58 (79%), Gaps = 6/58 (10%) Frame = -2 Query: 327 AVATEWFSHCNVLR-ETSS-----PAAARLVRTLMYAVRIGLAYLVMLAVMSFNAGVF 172 A+ EW SHCN+LR ET+S AA +++T++YAVRIGLAYLVMLAVMSFNAGVF Sbjct: 8 ALTVEWLSHCNILRPETASNRRGAAAAIGVMQTVLYAVRIGLAYLVMLAVMSFNAGVF 65 >ref|XP_012840081.1| PREDICTED: copper transporter 1-like, partial [Erythranthe guttata] Length = 119 Score = 71.2 bits (173), Expect = 7e-14 Identities = 38/58 (65%), Positives = 46/58 (79%), Gaps = 6/58 (10%) Frame = -2 Query: 327 AVATEWFSHCNVLR-ETSS-----PAAARLVRTLMYAVRIGLAYLVMLAVMSFNAGVF 172 A+ EW SHCN+LR ET+S AA +++T++YAVRIGLAYLVMLAVMSFNAGVF Sbjct: 25 ALTVEWLSHCNILRPETASNRRGAAAAIGVMQTVLYAVRIGLAYLVMLAVMSFNAGVF 82 >ref|XP_012835839.1| PREDICTED: copper transporter 6 [Erythranthe guttata] Length = 170 Score = 72.4 bits (176), Expect = 8e-14 Identities = 39/59 (66%), Positives = 47/59 (79%), Gaps = 7/59 (11%) Frame = -2 Query: 327 AVATEWFSHCNVLR-ETSSP------AAARLVRTLMYAVRIGLAYLVMLAVMSFNAGVF 172 A+A EW SHCN+LR ET+S AA +++T++YAVRIGLAYLVMLAVMSFNAGVF Sbjct: 75 ALAVEWLSHCNILRPETASSRRGSAAAAIGVMQTVLYAVRIGLAYLVMLAVMSFNAGVF 133 >ref|XP_011035246.1| PREDICTED: copper transporter 1-like [Populus euphratica] Length = 159 Score = 71.6 bits (174), Expect = 1e-13 Identities = 31/52 (59%), Positives = 42/52 (80%) Frame = -2 Query: 327 AVATEWFSHCNVLRETSSPAAARLVRTLMYAVRIGLAYLVMLAVMSFNAGVF 172 ++ EW SHC +++ S P AA LV+TL++A+R+GLAY+VMLAVMSFN GVF Sbjct: 72 SILVEWLSHCRLVKPGSGPVAAGLVQTLLHALRVGLAYMVMLAVMSFNGGVF 123 >ref|XP_002298334.2| hypothetical protein POPTR_0001s25290g [Populus trichocarpa] gi|550348147|gb|EEE83139.2| hypothetical protein POPTR_0001s25290g [Populus trichocarpa] Length = 159 Score = 70.9 bits (172), Expect = 3e-13 Identities = 30/52 (57%), Positives = 42/52 (80%) Frame = -2 Query: 327 AVATEWFSHCNVLRETSSPAAARLVRTLMYAVRIGLAYLVMLAVMSFNAGVF 172 ++ EW SHC +++ S P AA LV+TL++A+R+G+AY+VMLAVMSFN GVF Sbjct: 72 SILVEWLSHCRLIKPGSGPVAAGLVQTLLHALRVGVAYMVMLAVMSFNGGVF 123 >ref|XP_008384899.1| PREDICTED: copper transporter 1-like [Malus domestica] Length = 160 Score = 70.5 bits (171), Expect = 4e-13 Identities = 33/52 (63%), Positives = 39/52 (75%) Frame = -2 Query: 327 AVATEWFSHCNVLRETSSPAAARLVRTLMYAVRIGLAYLVMLAVMSFNAGVF 172 AV EW SHC ++R S L +TL++AVR+GLAYLVMLAVMSFNAGVF Sbjct: 72 AVLVEWLSHCRLIRAGGSDVVCGLAQTLLHAVRVGLAYLVMLAVMSFNAGVF 123 >ref|XP_002313412.1| copper transporter family protein [Populus trichocarpa] gi|222849820|gb|EEE87367.1| copper transporter family protein [Populus trichocarpa] Length = 155 Score = 70.1 bits (170), Expect = 5e-13 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -2 Query: 327 AVATEWFSHCNVLRETSSPAAARLVRTLMYAVRIGLAYLVMLAVMSFNAGVF 172 AV EW SHC +++ S+ AA L++ LM+AVR+GLAY+VMLAVMSFN GVF Sbjct: 66 AVLVEWLSHCRLVKPGSNNVAAGLIQALMHAVRVGLAYMVMLAVMSFNGGVF 117 >ref|XP_004309719.1| PREDICTED: copper transporter 1-like [Fragaria vesca subsp. vesca] Length = 156 Score = 70.1 bits (170), Expect = 5e-13 Identities = 32/52 (61%), Positives = 40/52 (76%) Frame = -2 Query: 327 AVATEWFSHCNVLRETSSPAAARLVRTLMYAVRIGLAYLVMLAVMSFNAGVF 172 AV EW SHC +L+ S AA LV+TL++ +R+GL Y+VMLAVMSFNAGVF Sbjct: 69 AVLVEWLSHCRILKAGSGHVAAGLVQTLLHCLRVGLGYMVMLAVMSFNAGVF 120 >ref|XP_008355761.1| PREDICTED: copper transporter 6-like [Malus domestica] Length = 157 Score = 70.1 bits (170), Expect = 5e-13 Identities = 31/52 (59%), Positives = 41/52 (78%) Frame = -2 Query: 327 AVATEWFSHCNVLRETSSPAAARLVRTLMYAVRIGLAYLVMLAVMSFNAGVF 172 AV EW SHC ++R ++S + L +T ++A+R+GLAYLVMLAVMSFNAGVF Sbjct: 69 AVLVEWLSHCRLIRPSASDVISGLAQTFLHAIRVGLAYLVMLAVMSFNAGVF 120 >ref|XP_006424958.1| hypothetical protein CICLE_v10029475mg [Citrus clementina] gi|557526892|gb|ESR38198.1| hypothetical protein CICLE_v10029475mg [Citrus clementina] Length = 124 Score = 68.9 bits (167), Expect = 6e-13 Identities = 29/52 (55%), Positives = 42/52 (80%) Frame = -2 Query: 327 AVATEWFSHCNVLRETSSPAAARLVRTLMYAVRIGLAYLVMLAVMSFNAGVF 172 AV EW SHC +++ ++ AA L++TL++A+R+GLA+LVMLA+MSFN GVF Sbjct: 69 AVLVEWLSHCKLMKPDANHVAAGLIQTLLHAIRVGLAFLVMLAIMSFNGGVF 120 >ref|XP_009785614.1| PREDICTED: copper transporter 6-like [Nicotiana sylvestris] Length = 157 Score = 69.7 bits (169), Expect = 7e-13 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -2 Query: 327 AVATEWFSHCNVLRETSSPAAARLVRTLMYAVRIGLAYLVMLAVMSFNAGVF 172 A EW SH N ++E+++ AA L++T +Y VRIGLAYLVMLAVMSFNAG+F Sbjct: 66 AFFVEWISHTNYIKESANHVAAGLIQTALYGVRIGLAYLVMLAVMSFNAGIF 117 >ref|XP_015886064.1| PREDICTED: copper transporter 1-like [Ziziphus jujuba] gi|1009114779|ref|XP_015873872.1| PREDICTED: copper transporter 1-like [Ziziphus jujuba] Length = 158 Score = 69.7 bits (169), Expect = 7e-13 Identities = 30/52 (57%), Positives = 42/52 (80%) Frame = -2 Query: 327 AVATEWFSHCNVLRETSSPAAARLVRTLMYAVRIGLAYLVMLAVMSFNAGVF 172 A+ EW SHC ++++ S+ AA LV+T ++A+R+GLAY+VMLAVMSFN GVF Sbjct: 71 ALLVEWLSHCKLIKDGSNHVAAGLVQTFLHAIRVGLAYMVMLAVMSFNVGVF 122 >ref|XP_011032214.1| PREDICTED: copper transporter 6-like [Populus euphratica] Length = 156 Score = 68.9 bits (167), Expect = 1e-12 Identities = 31/52 (59%), Positives = 41/52 (78%) Frame = -2 Query: 327 AVATEWFSHCNVLRETSSPAAARLVRTLMYAVRIGLAYLVMLAVMSFNAGVF 172 AV EW SHC +++ ++ AA L++ LM+AVR+GLAY+VMLAVMSFN GVF Sbjct: 67 AVLVEWLSHCRLVKPGTNNVAAGLIQALMHAVRVGLAYMVMLAVMSFNGGVF 118 >ref|XP_006424959.1| hypothetical protein CICLE_v10029475mg [Citrus clementina] gi|568870462|ref|XP_006488421.1| PREDICTED: copper transporter 1-like [Citrus sinensis] gi|557526893|gb|ESR38199.1| hypothetical protein CICLE_v10029475mg [Citrus clementina] Length = 156 Score = 68.9 bits (167), Expect = 1e-12 Identities = 29/52 (55%), Positives = 42/52 (80%) Frame = -2 Query: 327 AVATEWFSHCNVLRETSSPAAARLVRTLMYAVRIGLAYLVMLAVMSFNAGVF 172 AV EW SHC +++ ++ AA L++TL++A+R+GLA+LVMLA+MSFN GVF Sbjct: 69 AVLVEWLSHCKLMKPDANHVAAGLIQTLLHAIRVGLAFLVMLAIMSFNGGVF 120 >ref|XP_002313411.1| Copper transporter 1 family protein [Populus trichocarpa] gi|118485983|gb|ABK94836.1| unknown [Populus trichocarpa] gi|222849819|gb|EEE87366.1| Copper transporter 1 family protein [Populus trichocarpa] Length = 162 Score = 68.6 bits (166), Expect = 2e-12 Identities = 29/52 (55%), Positives = 42/52 (80%) Frame = -2 Query: 327 AVATEWFSHCNVLRETSSPAAARLVRTLMYAVRIGLAYLVMLAVMSFNAGVF 172 ++ EW SHC +++ S+ AA LV+TL++A+R+GLAY+VMLA+MSFN GVF Sbjct: 75 SILVEWLSHCQLMKPGSNHVAAGLVQTLLHALRVGLAYMVMLAIMSFNGGVF 126 >emb|CDP09123.1| unnamed protein product [Coffea canephora] Length = 133 Score = 67.8 bits (164), Expect = 2e-12 Identities = 34/52 (65%), Positives = 41/52 (78%), Gaps = 1/52 (1%) Frame = -2 Query: 324 VATEWFSHCNVLRETSSP-AAARLVRTLMYAVRIGLAYLVMLAVMSFNAGVF 172 V EW S C ++E+S+ AA LV+TLMY +RIGLAY+VMLAVMSFNAGVF Sbjct: 46 VVVEWLSACKFIKESSNNNVAAGLVQTLMYGIRIGLAYMVMLAVMSFNAGVF 97 >ref|XP_008349588.1| PREDICTED: copper transporter 1-like [Malus domestica] Length = 151 Score = 68.2 bits (165), Expect = 2e-12 Identities = 31/52 (59%), Positives = 41/52 (78%) Frame = -2 Query: 327 AVATEWFSHCNVLRETSSPAAARLVRTLMYAVRIGLAYLVMLAVMSFNAGVF 172 AV EW S+C ++R +S + L++TL++A+R GLAYLVMLAVMSFNAGVF Sbjct: 63 AVLVEWLSYCRLIRAGASDVVSGLIQTLLHAIRXGLAYLVMLAVMSFNAGVF 114