BLASTX nr result
ID: Rehmannia28_contig00025777
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00025777 (630 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP01836.1| unnamed protein product [Coffea canephora] 56 9e-07 >emb|CDP01836.1| unnamed protein product [Coffea canephora] Length = 151 Score = 56.2 bits (134), Expect = 9e-07 Identities = 42/95 (44%), Positives = 45/95 (47%) Frame = -3 Query: 628 PGGNARGLPLLVTILGSKTLXXXXXXXXXXXXXXXXXXVMIMGTGGLLDAHLIEVVDVIT 449 PGGN GL LV ILG K + M MG GGL HLI DVIT Sbjct: 35 PGGNGLGLQHLVIILGLKAVGAMVFVVTVVGIAEDLAM-MTMGIGGLPSDHLI-AADVIT 92 Query: 448 LLDVHVLAEDQEGTGPDHILLEGVLRGTMHVVLGE 344 H + E QEG G ILL VL+GTM V L E Sbjct: 93 PPSDHHMVEGQEGIGQGPILLTVVLKGTMLVALDE 127