BLASTX nr result
ID: Rehmannia28_contig00025691
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00025691 (371 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081544.1| PREDICTED: E3 ubiquitin-protein ligase KEG [... 55 2e-06 >ref|XP_011081544.1| PREDICTED: E3 ubiquitin-protein ligase KEG [Sesamum indicum] Length = 623 Score = 54.7 bits (130), Expect = 2e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -1 Query: 320 KNHVVQNENQNVDSQIAKNSAWRPPKVTEIFR 225 KN VVQN+NQNVD Q A N+ WRPPKVT IFR Sbjct: 592 KNTVVQNDNQNVDGQSANNAVWRPPKVTNIFR 623