BLASTX nr result
ID: Rehmannia28_contig00025527
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00025527 (362 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076217.1| PREDICTED: F-box protein At4g00755-like isof... 60 2e-08 ref|XP_011076218.1| PREDICTED: F-box protein At4g00755-like isof... 59 9e-08 ref|XP_012852261.1| PREDICTED: F-box protein At4g00755-like [Ery... 58 1e-07 >ref|XP_011076217.1| PREDICTED: F-box protein At4g00755-like isoform X1 [Sesamum indicum] Length = 388 Score = 60.5 bits (145), Expect = 2e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 94 KMDGSRDFIQWLGQDMALKILLCLEDPSDLV 2 KMDGS DFIQW+G+DM+LKIL+CLEDPSDLV Sbjct: 17 KMDGSLDFIQWVGEDMSLKILMCLEDPSDLV 47 >ref|XP_011076218.1| PREDICTED: F-box protein At4g00755-like isoform X2 [Sesamum indicum] Length = 371 Score = 58.5 bits (140), Expect = 9e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 91 MDGSRDFIQWLGQDMALKILLCLEDPSDLV 2 MDGS DFIQW+G+DM+LKIL+CLEDPSDLV Sbjct: 1 MDGSLDFIQWVGEDMSLKILMCLEDPSDLV 30 >ref|XP_012852261.1| PREDICTED: F-box protein At4g00755-like [Erythranthe guttata] gi|604306006|gb|EYU25063.1| hypothetical protein MIMGU_mgv1a008775mg [Erythranthe guttata] Length = 363 Score = 58.2 bits (139), Expect = 1e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 91 MDGSRDFIQWLGQDMALKILLCLEDPSDLV 2 M GSRDFI+WLGQDM+LKI +CLEDPSDLV Sbjct: 1 MKGSRDFIEWLGQDMSLKIFMCLEDPSDLV 30