BLASTX nr result
ID: Rehmannia28_contig00025478
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00025478 (430 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36636.1| hypothetical protein MIMGU_mgv1a001743mg [Erythra... 87 2e-17 ref|XP_012839030.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-17 ref|XP_011074015.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-15 ref|XP_011074014.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-15 ref|XP_008245604.1| PREDICTED: pentatricopeptide repeat-containi... 71 8e-13 ref|XP_008245601.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-12 ref|XP_008231248.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 71 8e-12 ref|XP_007219492.1| hypothetical protein PRUPE_ppa022231mg [Prun... 71 8e-12 gb|EPS73550.1| hypothetical protein M569_01210, partial [Genlise... 68 4e-11 ref|XP_004292914.1| PREDICTED: pentatricopeptide repeat-containi... 66 6e-10 ref|XP_006342120.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-09 ref|XP_006342119.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-09 ref|XP_006342118.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-09 ref|XP_010320451.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-09 ref|XP_004238420.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-09 ref|XP_007018002.1| Tetratricopeptide repeat (TPR)-like superfam... 64 4e-09 ref|XP_009619801.1| PREDICTED: pentatricopeptide repeat-containi... 63 5e-09 ref|XP_009777646.1| PREDICTED: pentatricopeptide repeat-containi... 63 5e-09 ref|XP_009777644.1| PREDICTED: pentatricopeptide repeat-containi... 63 5e-09 ref|XP_015071502.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-09 >gb|EYU36636.1| hypothetical protein MIMGU_mgv1a001743mg [Erythranthe guttata] Length = 766 Score = 87.0 bits (214), Expect = 2e-17 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -2 Query: 429 IIEIFKDSAYIAVALLYLRWCATLLYPISWLPNQSPWAKRLSSNY 295 IIEIFKDSAY+AVALL LRWCATL++PISWLPNQSPWAKRLS +Y Sbjct: 716 IIEIFKDSAYLAVALLNLRWCATLMFPISWLPNQSPWAKRLSIDY 760 >ref|XP_012839030.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 [Erythranthe guttata] Length = 819 Score = 87.0 bits (214), Expect = 2e-17 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -2 Query: 429 IIEIFKDSAYIAVALLYLRWCATLLYPISWLPNQSPWAKRLSSNY 295 IIEIFKDSAY+AVALL LRWCATL++PISWLPNQSPWAKRLS +Y Sbjct: 769 IIEIFKDSAYLAVALLNLRWCATLMFPISWLPNQSPWAKRLSIDY 813 >ref|XP_011074015.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 isoform X2 [Sesamum indicum] Length = 780 Score = 82.4 bits (202), Expect = 1e-15 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -2 Query: 429 IIEIFKDSAYIAVALLYLRWCATLLYPISWLPNQSPWAKRLS 304 I+E+FKDSAY+AVA+LYLRWCAT +PISWLPNQSPWAKRLS Sbjct: 731 ILEVFKDSAYLAVAILYLRWCATFGFPISWLPNQSPWAKRLS 772 >ref|XP_011074014.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 isoform X1 [Sesamum indicum] Length = 816 Score = 82.4 bits (202), Expect = 1e-15 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -2 Query: 429 IIEIFKDSAYIAVALLYLRWCATLLYPISWLPNQSPWAKRLS 304 I+E+FKDSAY+AVA+LYLRWCAT +PISWLPNQSPWAKRLS Sbjct: 767 ILEVFKDSAYLAVAILYLRWCATFGFPISWLPNQSPWAKRLS 808 >ref|XP_008245604.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like [Prunus mume] Length = 182 Score = 71.2 bits (173), Expect = 8e-13 Identities = 33/46 (71%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = -2 Query: 429 IIEIFKDSAY-IAVALLYLRWCATLLYPISWLPNQSPWAKRLSSNY 295 I+++FKDS +AVALL LRWCA L +PISW PNQSPWA+RLSSNY Sbjct: 130 IVQLFKDSEEKLAVALLNLRWCAVLGFPISWSPNQSPWARRLSSNY 175 >ref|XP_008245601.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like [Prunus mume] Length = 216 Score = 71.2 bits (173), Expect = 2e-12 Identities = 33/46 (71%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = -2 Query: 429 IIEIFKDSAY-IAVALLYLRWCATLLYPISWLPNQSPWAKRLSSNY 295 I+++FKDS +AVALL LRWCA L +PISW PNQSPWA+RLSSNY Sbjct: 164 IVQLFKDSEEKLAVALLNLRWCAVLGFPISWSPNQSPWARRLSSNY 209 >ref|XP_008231248.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g76280-like [Prunus mume] Length = 724 Score = 71.2 bits (173), Expect = 8e-12 Identities = 33/46 (71%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = -2 Query: 429 IIEIFKDSAY-IAVALLYLRWCATLLYPISWLPNQSPWAKRLSSNY 295 I+++FKDS +AVALL LRWCA L +PISW PNQSPWA+RLSSNY Sbjct: 672 IVQLFKDSEEKLAVALLNLRWCAVLGFPISWSPNQSPWARRLSSNY 717 >ref|XP_007219492.1| hypothetical protein PRUPE_ppa022231mg [Prunus persica] gi|462415954|gb|EMJ20691.1| hypothetical protein PRUPE_ppa022231mg [Prunus persica] Length = 772 Score = 71.2 bits (173), Expect = 8e-12 Identities = 33/46 (71%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = -2 Query: 429 IIEIFKDSAY-IAVALLYLRWCATLLYPISWLPNQSPWAKRLSSNY 295 I+++FKDS +AVALL LRWCA L +PISW PNQSPWA+RLSSNY Sbjct: 720 IVQLFKDSEENLAVALLNLRWCAVLGFPISWSPNQSPWARRLSSNY 765 >gb|EPS73550.1| hypothetical protein M569_01210, partial [Genlisea aurea] Length = 227 Score = 67.8 bits (164), Expect = 4e-11 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -2 Query: 429 IIEIFKDSAYIAVALLYLRWCATLLYPISWLPNQSPWAKRLSSNY 295 I+ IF +S Y+A ALLYLRWCATL++ ISW P++SPWAKRLS+ Y Sbjct: 183 IVGIFDESPYLAAALLYLRWCATLVH-ISWTPSESPWAKRLSAGY 226 >ref|XP_004292914.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 [Fragaria vesca subsp. vesca] Length = 828 Score = 65.9 bits (159), Expect = 6e-10 Identities = 32/46 (69%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = -2 Query: 429 IIEIFKDSAY-IAVALLYLRWCATLLYPISWLPNQSPWAKRLSSNY 295 II+ FKDS +A ALL LRWCA L +PISWLP+QSPW KRLS+NY Sbjct: 776 IIKHFKDSEENLAFALLNLRWCAMLGFPISWLPDQSPWVKRLSTNY 821 >ref|XP_006342120.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 isoform X3 [Solanum tuberosum] Length = 683 Score = 64.3 bits (155), Expect = 2e-09 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -2 Query: 429 IIEIFKDSA-YIAVALLYLRWCATLLYPISWLPNQSPWAKRLSSN 298 I+E FKDS Y+ VALL LRWCA L YP+SW P+ S WA+RLSSN Sbjct: 631 ILETFKDSKEYLTVALLQLRWCAILGYPVSWSPSDSQWARRLSSN 675 >ref|XP_006342119.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 isoform X2 [Solanum tuberosum] Length = 770 Score = 64.3 bits (155), Expect = 2e-09 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -2 Query: 429 IIEIFKDSA-YIAVALLYLRWCATLLYPISWLPNQSPWAKRLSSN 298 I+E FKDS Y+ VALL LRWCA L YP+SW P+ S WA+RLSSN Sbjct: 718 ILETFKDSKEYLTVALLQLRWCAILGYPVSWSPSDSQWARRLSSN 762 >ref|XP_006342118.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 isoform X1 [Solanum tuberosum] Length = 806 Score = 64.3 bits (155), Expect = 2e-09 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -2 Query: 429 IIEIFKDSA-YIAVALLYLRWCATLLYPISWLPNQSPWAKRLSSN 298 I+E FKDS Y+ VALL LRWCA L YP+SW P+ S WA+RLSSN Sbjct: 754 ILETFKDSKEYLTVALLQLRWCAILGYPVSWSPSDSQWARRLSSN 798 >ref|XP_010320451.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 isoform X2 [Solanum lycopersicum] Length = 696 Score = 63.9 bits (154), Expect = 3e-09 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = -2 Query: 429 IIEIFKDSA-YIAVALLYLRWCATLLYPISWLPNQSPWAKRLSSNY 295 I++ FKDS Y+ VALL LRWCA L YP+SW P+ S WA+RLSSN+ Sbjct: 644 ILKTFKDSKEYLTVALLQLRWCAILGYPVSWSPSDSQWARRLSSNF 689 >ref|XP_004238420.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 isoform X1 [Solanum lycopersicum] Length = 799 Score = 63.9 bits (154), Expect = 3e-09 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = -2 Query: 429 IIEIFKDSA-YIAVALLYLRWCATLLYPISWLPNQSPWAKRLSSNY 295 I++ FKDS Y+ VALL LRWCA L YP+SW P+ S WA+RLSSN+ Sbjct: 747 ILKTFKDSKEYLTVALLQLRWCAILGYPVSWSPSDSQWARRLSSNF 792 >ref|XP_007018002.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508723330|gb|EOY15227.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 814 Score = 63.5 bits (153), Expect = 4e-09 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = -2 Query: 429 IIEIFKDSA-YIAVALLYLRWCATLLYPISWLPNQSPWAKRLSSNY 295 I++ FKDS ++AVALL LRWCA L +PISW PNQS W +RL +NY Sbjct: 761 ILQFFKDSEEHLAVALLNLRWCAMLGFPISWSPNQSGWVRRLKTNY 806 >ref|XP_009619801.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 isoform X1 [Nicotiana tomentosiformis] Length = 799 Score = 63.2 bits (152), Expect = 5e-09 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = -2 Query: 429 IIEIFKDSA-YIAVALLYLRWCATLLYPISWLPNQSPWAKRLSSN 298 I+E FKDS Y+ VALL LRWCA L YP+SW P++S WA+RLS+N Sbjct: 752 ILEPFKDSKEYLTVALLQLRWCAILGYPVSWSPSESQWARRLSNN 796 >ref|XP_009777646.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 isoform X2 [Nicotiana sylvestris] Length = 804 Score = 63.2 bits (152), Expect = 5e-09 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = -2 Query: 429 IIEIFKDSA-YIAVALLYLRWCATLLYPISWLPNQSPWAKRLSSN 298 I+E FKDS Y+ VALL LRWCA L YP+SW P++S WA+RLS+N Sbjct: 752 ILEPFKDSKEYLTVALLQLRWCAILGYPVSWSPSESQWARRLSNN 796 >ref|XP_009777644.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 isoform X1 [Nicotiana sylvestris] Length = 809 Score = 63.2 bits (152), Expect = 5e-09 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = -2 Query: 429 IIEIFKDSA-YIAVALLYLRWCATLLYPISWLPNQSPWAKRLSSN 298 I+E FKDS Y+ VALL LRWCA L YP+SW P++S WA+RLS+N Sbjct: 757 ILEPFKDSKEYLTVALLQLRWCAILGYPVSWSPSESQWARRLSNN 801 >ref|XP_015071502.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 isoform X2 [Solanum pennellii] Length = 705 Score = 62.8 bits (151), Expect = 7e-09 Identities = 29/45 (64%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -2 Query: 429 IIEIFKDSA-YIAVALLYLRWCATLLYPISWLPNQSPWAKRLSSN 298 I++ FKDS Y+ VALL LRWCA L YP+SW P+ S WA+RLSSN Sbjct: 653 ILKTFKDSKEYLTVALLQLRWCAILGYPVSWSPSDSQWARRLSSN 697