BLASTX nr result
ID: Rehmannia28_contig00025428
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00025428 (323 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011079842.1| PREDICTED: pentatricopeptide repeat-containi... 166 5e-47 ref|XP_012832451.1| PREDICTED: pentatricopeptide repeat-containi... 165 9e-47 ref|XP_015892090.1| PREDICTED: pentatricopeptide repeat-containi... 149 1e-40 ref|XP_010662166.1| PREDICTED: pentatricopeptide repeat-containi... 146 6e-40 ref|XP_010662164.1| PREDICTED: pentatricopeptide repeat-containi... 146 1e-39 emb|CAN64701.1| hypothetical protein VITISV_037299 [Vitis vinifera] 146 8e-39 ref|XP_007050629.1| Pentatricopeptide repeat (PPR) superfamily p... 141 1e-37 gb|KHG24373.1| hypothetical protein F383_30483 [Gossypium arboreum] 140 2e-37 emb|CDP03624.1| unnamed protein product [Coffea canephora] 138 2e-36 ref|XP_012473935.1| PREDICTED: pentatricopeptide repeat-containi... 136 2e-36 ref|XP_012473934.1| PREDICTED: pentatricopeptide repeat-containi... 136 8e-36 ref|XP_009615280.1| PREDICTED: pentatricopeptide repeat-containi... 134 4e-35 gb|KDO68752.1| hypothetical protein CISIN_1g010458mg [Citrus sin... 132 4e-35 ref|XP_009768016.1| PREDICTED: pentatricopeptide repeat-containi... 134 7e-35 ref|XP_006444085.1| hypothetical protein CICLE_v10019771mg [Citr... 132 2e-34 ref|XP_007198989.1| hypothetical protein PRUPE_ppa004422mg [Prun... 132 2e-34 ref|XP_015575612.1| PREDICTED: pentatricopeptide repeat-containi... 130 8e-34 ref|XP_010255941.1| PREDICTED: pentatricopeptide repeat-containi... 130 8e-34 ref|XP_010091037.1| hypothetical protein L484_006401 [Morus nota... 130 9e-34 ref|XP_010693618.1| PREDICTED: pentatricopeptide repeat-containi... 130 9e-34 >ref|XP_011079842.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial [Sesamum indicum] Length = 523 Score = 166 bits (420), Expect = 5e-47 Identities = 74/93 (79%), Positives = 88/93 (94%) Frame = -2 Query: 280 YNEWESISPTKDSRVPNLLLAAYINNNKMEVAEAFYDRMVKRDIVPGYTTWELLTWGYLK 101 Y+EWES+SPT DSRVPNLLLAAYIN ++ME AEAFYDRMV++DIVPGYTTWELLTWGYLK Sbjct: 351 YDEWESVSPTNDSRVPNLLLAAYINQDQMEKAEAFYDRMVQKDIVPGYTTWELLTWGYLK 410 Query: 100 QKRLDKVLDCFKKAVTSVRKWDPDEEMVQEVFR 2 Q+++DKVLDCFKKA+ SVRKWDPDE++V++V R Sbjct: 411 QRQVDKVLDCFKKAIGSVRKWDPDEKLVEKVCR 443 >ref|XP_012832451.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial [Erythranthe guttata] gi|604348434|gb|EYU46589.1| hypothetical protein MIMGU_mgv1a004554mg [Erythranthe guttata] Length = 521 Score = 165 bits (418), Expect = 9e-47 Identities = 73/92 (79%), Positives = 87/92 (94%) Frame = -2 Query: 280 YNEWESISPTKDSRVPNLLLAAYINNNKMEVAEAFYDRMVKRDIVPGYTTWELLTWGYLK 101 YNEWESISPTKD+RVPNLLL++YI+NN M+ AEAFY+RMV+ D+VPGYTTWELLTWGYLK Sbjct: 349 YNEWESISPTKDTRVPNLLLSSYISNNGMDKAEAFYNRMVENDLVPGYTTWELLTWGYLK 408 Query: 100 QKRLDKVLDCFKKAVTSVRKWDPDEEMVQEVF 5 Q+ LD+VLDCFKKA++SVRKWDPDE++V EVF Sbjct: 409 QRDLDRVLDCFKKAISSVRKWDPDEKLVHEVF 440 >ref|XP_015892090.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial [Ziziphus jujuba] Length = 513 Score = 149 bits (376), Expect = 1e-40 Identities = 67/93 (72%), Positives = 81/93 (87%) Frame = -2 Query: 280 YNEWESISPTKDSRVPNLLLAAYINNNKMEVAEAFYDRMVKRDIVPGYTTWELLTWGYLK 101 YNEWESIS T D+RVPN+LLAAYIN N+ME AE FYDR+ ++ I P YTTWELLTWGYLK Sbjct: 340 YNEWESISGTGDARVPNILLAAYINRNQMETAEIFYDRLAEKGINPCYTTWELLTWGYLK 399 Query: 100 QKRLDKVLDCFKKAVTSVRKWDPDEEMVQEVFR 2 +K++DKVLD FKKAV SV+KWDPD+ +V+EVF+ Sbjct: 400 EKQMDKVLDYFKKAVNSVKKWDPDDRLVREVFK 432 >ref|XP_010662166.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial isoform X2 [Vitis vinifera] Length = 470 Score = 146 bits (369), Expect = 6e-40 Identities = 64/93 (68%), Positives = 84/93 (90%) Frame = -2 Query: 280 YNEWESISPTKDSRVPNLLLAAYINNNKMEVAEAFYDRMVKRDIVPGYTTWELLTWGYLK 101 Y+EW S+SPT DSRVPN+LLAAYIN N+ME+AE FY++MV+R I P YTTWELLTWGYLK Sbjct: 295 YSEWTSVSPTGDSRVPNILLAAYINKNEMEMAEKFYNQMVERGITPSYTTWELLTWGYLK 354 Query: 100 QKRLDKVLDCFKKAVTSVRKWDPDEEMVQEVFR 2 +K+++KVLD F+KAV SV+KW+PDE++V+EV++ Sbjct: 355 KKQMEKVLDYFEKAVGSVKKWNPDEKLVREVYK 387 >ref|XP_010662164.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial isoform X1 [Vitis vinifera] gi|731422588|ref|XP_010662165.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial isoform X1 [Vitis vinifera] gi|297737393|emb|CBI26594.3| unnamed protein product [Vitis vinifera] Length = 529 Score = 146 bits (369), Expect = 1e-39 Identities = 64/93 (68%), Positives = 84/93 (90%) Frame = -2 Query: 280 YNEWESISPTKDSRVPNLLLAAYINNNKMEVAEAFYDRMVKRDIVPGYTTWELLTWGYLK 101 Y+EW S+SPT DSRVPN+LLAAYIN N+ME+AE FY++MV+R I P YTTWELLTWGYLK Sbjct: 354 YSEWTSVSPTGDSRVPNILLAAYINKNEMEMAEKFYNQMVERGITPSYTTWELLTWGYLK 413 Query: 100 QKRLDKVLDCFKKAVTSVRKWDPDEEMVQEVFR 2 +K+++KVLD F+KAV SV+KW+PDE++V+EV++ Sbjct: 414 KKQMEKVLDYFEKAVGSVKKWNPDEKLVREVYK 446 >emb|CAN64701.1| hypothetical protein VITISV_037299 [Vitis vinifera] Length = 1111 Score = 146 bits (369), Expect = 8e-39 Identities = 64/93 (68%), Positives = 84/93 (90%) Frame = -2 Query: 280 YNEWESISPTKDSRVPNLLLAAYINNNKMEVAEAFYDRMVKRDIVPGYTTWELLTWGYLK 101 Y+EW S+SPT DSRVPN+LLAAYIN N+ME+AE FY++MV+R I P YTTWELLTWGYLK Sbjct: 354 YSEWTSVSPTGDSRVPNILLAAYINKNEMEMAEKFYNQMVERGITPSYTTWELLTWGYLK 413 Query: 100 QKRLDKVLDCFKKAVTSVRKWDPDEEMVQEVFR 2 +K+++KVLD F+KAV SV+KW+PDE++V+EV++ Sbjct: 414 KKQMEKVLDYFEKAVGSVKKWNPDEKLVREVYK 446 >ref|XP_007050629.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508702890|gb|EOX94786.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 513 Score = 141 bits (355), Expect = 1e-37 Identities = 61/93 (65%), Positives = 81/93 (87%) Frame = -2 Query: 280 YNEWESISPTKDSRVPNLLLAAYINNNKMEVAEAFYDRMVKRDIVPGYTTWELLTWGYLK 101 YNEWES+S + D+RVPN+LLAAYIN +ME+AE FY+R+V++ I P YTTWELLTWGYLK Sbjct: 341 YNEWESVSGSADARVPNILLAAYINQERMEIAEDFYERIVQKGISPCYTTWELLTWGYLK 400 Query: 100 QKRLDKVLDCFKKAVTSVRKWDPDEEMVQEVFR 2 +R++KVLDCF++AV SVRKW+P++ +V EVF+ Sbjct: 401 NQRIEKVLDCFERAVGSVRKWNPNDRLVGEVFK 433 >gb|KHG24373.1| hypothetical protein F383_30483 [Gossypium arboreum] Length = 516 Score = 140 bits (353), Expect = 2e-37 Identities = 61/92 (66%), Positives = 83/92 (90%) Frame = -2 Query: 280 YNEWESISPTKDSRVPNLLLAAYINNNKMEVAEAFYDRMVKRDIVPGYTTWELLTWGYLK 101 YNEWES+S + D+RVPN+LLAAYIN +KM+VAE FY ++V++ I P YTTWELLTWGYLK Sbjct: 344 YNEWESVSGSGDARVPNILLAAYINGDKMDVAENFYQQIVQKGISPCYTTWELLTWGYLK 403 Query: 100 QKRLDKVLDCFKKAVTSVRKWDPDEEMVQEVF 5 +++++KVLDCFK+AV SV+KW+P+E++V+EVF Sbjct: 404 KQQMEKVLDCFKQAVCSVKKWNPNEKLVREVF 435 >emb|CDP03624.1| unnamed protein product [Coffea canephora] Length = 515 Score = 138 bits (347), Expect = 2e-36 Identities = 60/91 (65%), Positives = 77/91 (84%) Frame = -2 Query: 280 YNEWESISPTKDSRVPNLLLAAYINNNKMEVAEAFYDRMVKRDIVPGYTTWELLTWGYLK 101 Y EW SISPT DSR+PN+LLAAYIN+ ME+AE FY +MV++ + P YTTWELLTWGYLK Sbjct: 342 YMEWSSISPTGDSRIPNILLAAYINDGHMEMAEKFYKQMVEKGMTPSYTTWELLTWGYLK 401 Query: 100 QKRLDKVLDCFKKAVTSVRKWDPDEEMVQEV 8 K++++VLDCF KA+ SV+KW+PD +MV+EV Sbjct: 402 LKKVERVLDCFNKAIGSVKKWEPDVKMVKEV 432 >ref|XP_012473935.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial isoform X2 [Gossypium raimondii] Length = 413 Score = 136 bits (342), Expect = 2e-36 Identities = 58/92 (63%), Positives = 81/92 (88%) Frame = -2 Query: 280 YNEWESISPTKDSRVPNLLLAAYINNNKMEVAEAFYDRMVKRDIVPGYTTWELLTWGYLK 101 YNEWES+S + D+RVPN+LLA YIN +KM+VAE FY ++ ++ I P YTTWELLTWGYL+ Sbjct: 241 YNEWESVSGSGDARVPNILLATYINGDKMDVAENFYQQIAQKGISPCYTTWELLTWGYLR 300 Query: 100 QKRLDKVLDCFKKAVTSVRKWDPDEEMVQEVF 5 +++++KVLDCFK+AV SV+KW+P+E++V+EVF Sbjct: 301 KQQMEKVLDCFKQAVCSVKKWNPNEKLVREVF 332 >ref|XP_012473934.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial isoform X1 [Gossypium raimondii] gi|763755764|gb|KJB23095.1| hypothetical protein B456_004G080600 [Gossypium raimondii] Length = 515 Score = 136 bits (342), Expect = 8e-36 Identities = 58/92 (63%), Positives = 81/92 (88%) Frame = -2 Query: 280 YNEWESISPTKDSRVPNLLLAAYINNNKMEVAEAFYDRMVKRDIVPGYTTWELLTWGYLK 101 YNEWES+S + D+RVPN+LLA YIN +KM+VAE FY ++ ++ I P YTTWELLTWGYL+ Sbjct: 343 YNEWESVSGSGDARVPNILLATYINGDKMDVAENFYQQIAQKGISPCYTTWELLTWGYLR 402 Query: 100 QKRLDKVLDCFKKAVTSVRKWDPDEEMVQEVF 5 +++++KVLDCFK+AV SV+KW+P+E++V+EVF Sbjct: 403 KQQMEKVLDCFKQAVCSVKKWNPNEKLVREVF 434 >ref|XP_009615280.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial [Nicotiana tomentosiformis] Length = 545 Score = 134 bits (338), Expect = 4e-35 Identities = 62/92 (67%), Positives = 75/92 (81%) Frame = -2 Query: 280 YNEWESISPTKDSRVPNLLLAAYINNNKMEVAEAFYDRMVKRDIVPGYTTWELLTWGYLK 101 Y EWES+S T+DSR+ NLLLAAYIN N+ME A F++R V++ + YTTWELLTWGYLK Sbjct: 372 YTEWESVSVTRDSRISNLLLAAYINKNEMEKAVDFHNRTVQKGVSSSYTTWELLTWGYLK 431 Query: 100 QKRLDKVLDCFKKAVTSVRKWDPDEEMVQEVF 5 QK + KVL+ FKKAVTSV KWDPD +MVQE+F Sbjct: 432 QKEMGKVLEFFKKAVTSVSKWDPDAKMVQEMF 463 >gb|KDO68752.1| hypothetical protein CISIN_1g010458mg [Citrus sinensis] Length = 415 Score = 132 bits (333), Expect = 4e-35 Identities = 58/92 (63%), Positives = 76/92 (82%) Frame = -2 Query: 280 YNEWESISPTKDSRVPNLLLAAYINNNKMEVAEAFYDRMVKRDIVPGYTTWELLTWGYLK 101 Y+EWESIS T D RVPN+LLAAYIN N++E+AE+FY+R+V + I P YTTWELLTWGYLK Sbjct: 242 YDEWESISGTGDPRVPNILLAAYINRNQLEMAESFYNRLVTKGIKPCYTTWELLTWGYLK 301 Query: 100 QKRLDKVLDCFKKAVTSVRKWDPDEEMVQEVF 5 + +++KVL+CFKKA+ SVRKW PD ++ + Sbjct: 302 KGQMEKVLECFKKAIGSVRKWVPDHRLITAAY 333 >ref|XP_009768016.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial [Nicotiana sylvestris] Length = 534 Score = 134 bits (336), Expect = 7e-35 Identities = 62/92 (67%), Positives = 75/92 (81%) Frame = -2 Query: 280 YNEWESISPTKDSRVPNLLLAAYINNNKMEVAEAFYDRMVKRDIVPGYTTWELLTWGYLK 101 Y EWES+S T+DSR+ NLLLAA IN N+ME A F++R V++ + P YTTWELLTWGYLK Sbjct: 361 YTEWESVSVTRDSRISNLLLAADINKNEMEKAVDFHNRTVQKGVSPSYTTWELLTWGYLK 420 Query: 100 QKRLDKVLDCFKKAVTSVRKWDPDEEMVQEVF 5 QK + KVL+ FKKAVTSV KWDPD +MVQE+F Sbjct: 421 QKEMGKVLEYFKKAVTSVSKWDPDAKMVQEMF 452 >ref|XP_006444085.1| hypothetical protein CICLE_v10019771mg [Citrus clementina] gi|568852124|ref|XP_006479730.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial [Citrus sinensis] gi|557546347|gb|ESR57325.1| hypothetical protein CICLE_v10019771mg [Citrus clementina] gi|641849877|gb|KDO68751.1| hypothetical protein CISIN_1g010458mg [Citrus sinensis] Length = 510 Score = 132 bits (333), Expect = 2e-34 Identities = 58/92 (63%), Positives = 76/92 (82%) Frame = -2 Query: 280 YNEWESISPTKDSRVPNLLLAAYINNNKMEVAEAFYDRMVKRDIVPGYTTWELLTWGYLK 101 Y+EWESIS T D RVPN+LLAAYIN N++E+AE+FY+R+V + I P YTTWELLTWGYLK Sbjct: 337 YDEWESISGTGDPRVPNILLAAYINRNQLEMAESFYNRLVTKGIKPCYTTWELLTWGYLK 396 Query: 100 QKRLDKVLDCFKKAVTSVRKWDPDEEMVQEVF 5 + +++KVL+CFKKA+ SVRKW PD ++ + Sbjct: 397 KGQMEKVLECFKKAIGSVRKWVPDHRLITAAY 428 >ref|XP_007198989.1| hypothetical protein PRUPE_ppa004422mg [Prunus persica] gi|462394389|gb|EMJ00188.1| hypothetical protein PRUPE_ppa004422mg [Prunus persica] Length = 511 Score = 132 bits (332), Expect = 2e-34 Identities = 59/92 (64%), Positives = 76/92 (82%) Frame = -2 Query: 280 YNEWESISPTKDSRVPNLLLAAYINNNKMEVAEAFYDRMVKRDIVPGYTTWELLTWGYLK 101 Y EWES+S T D+RV N+LLAAYIN ++ME+AE F++RMV+ I P Y+TWELLTWG+LK Sbjct: 338 YTEWESVSETHDARVSNILLAAYINKDQMEMAETFHNRMVQNGITPCYSTWELLTWGFLK 397 Query: 100 QKRLDKVLDCFKKAVTSVRKWDPDEEMVQEVF 5 QK +KVLD FKKAV SV++WDPD+ ++ EVF Sbjct: 398 QKHTEKVLDNFKKAVGSVKRWDPDKRLIGEVF 429 >ref|XP_015575612.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial [Ricinus communis] Length = 507 Score = 130 bits (328), Expect = 8e-34 Identities = 57/93 (61%), Positives = 76/93 (81%) Frame = -2 Query: 280 YNEWESISPTKDSRVPNLLLAAYINNNKMEVAEAFYDRMVKRDIVPGYTTWELLTWGYLK 101 Y EWES+S T D +V N+LLAAYIN N++E +E FY RMV++ + P YTTWELLTWG+LK Sbjct: 334 YTEWESVSGTGDPQVANILLAAYINRNQIEDSENFYRRMVEKGVCPCYTTWELLTWGHLK 393 Query: 100 QKRLDKVLDCFKKAVTSVRKWDPDEEMVQEVFR 2 K+++KVLDCFKKA+T V+ W PD+ +V+EVF+ Sbjct: 394 TKQMEKVLDCFKKAITIVKTWSPDKRLVREVFK 426 >ref|XP_010255941.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial [Nelumbo nucifera] Length = 513 Score = 130 bits (328), Expect = 8e-34 Identities = 58/92 (63%), Positives = 73/92 (79%) Frame = -2 Query: 280 YNEWESISPTKDSRVPNLLLAAYINNNKMEVAEAFYDRMVKRDIVPGYTTWELLTWGYLK 101 Y EWE +S T DSR+PNLLLAAYIN +M+ AE F +RMV++ I P YTTWEL WGYLK Sbjct: 339 YAEWEVVSGTGDSRIPNLLLAAYINQGQMDKAEKFCERMVQKGITPSYTTWELFAWGYLK 398 Query: 100 QKRLDKVLDCFKKAVTSVRKWDPDEEMVQEVF 5 K++DKVLD FKKA+ SV++WDP + +V+EVF Sbjct: 399 MKKMDKVLDYFKKAIESVKEWDPTDRIVREVF 430 >ref|XP_010091037.1| hypothetical protein L484_006401 [Morus notabilis] gi|587851919|gb|EXB42055.1| hypothetical protein L484_006401 [Morus notabilis] Length = 464 Score = 130 bits (326), Expect = 9e-34 Identities = 59/93 (63%), Positives = 77/93 (82%) Frame = -2 Query: 280 YNEWESISPTKDSRVPNLLLAAYINNNKMEVAEAFYDRMVKRDIVPGYTTWELLTWGYLK 101 Y EWE++S T DSR+PNLLLAAYIN+++M +AE+ Y RM+++DI YTT ELLTWGYLK Sbjct: 289 YAEWETVSGTNDSRIPNLLLAAYINSDQMGMAESLYKRMLEKDIAASYTTLELLTWGYLK 348 Query: 100 QKRLDKVLDCFKKAVTSVRKWDPDEEMVQEVFR 2 QK+++KV+ FK AV SV KWDPDE+ V+EVF+ Sbjct: 349 QKQVEKVVAYFKNAVNSVAKWDPDEKFVREVFK 381 >ref|XP_010693618.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial [Beta vulgaris subsp. vulgaris] gi|870867745|gb|KMT18614.1| hypothetical protein BVRB_2g027440 [Beta vulgaris subsp. vulgaris] Length = 528 Score = 130 bits (328), Expect = 9e-34 Identities = 56/93 (60%), Positives = 76/93 (81%) Frame = -2 Query: 280 YNEWESISPTKDSRVPNLLLAAYINNNKMEVAEAFYDRMVKRDIVPGYTTWELLTWGYLK 101 YNEWES+S T D+RVPNLL+ AY+ N+M+ A F+DR ++ I P YTTWELLT+GYLK Sbjct: 355 YNEWESVSTTGDTRVPNLLIGAYLKTNQMDKATKFFDRFTQKGIKPSYTTWELLTFGYLK 414 Query: 100 QKRLDKVLDCFKKAVTSVRKWDPDEEMVQEVFR 2 K++D+VLDCF+KAVTSVRKW+P+ ++EV++ Sbjct: 415 LKQIDRVLDCFEKAVTSVRKWEPNLTFIKEVYK 447