BLASTX nr result
ID: Rehmannia28_contig00025409
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00025409 (610 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO82583.1| hypothetical protein CISIN_1g028306mg [Citrus sin... 55 2e-06 gb|KDO82584.1| hypothetical protein CISIN_1g028306mg [Citrus sin... 54 7e-06 >gb|KDO82583.1| hypothetical protein CISIN_1g028306mg [Citrus sinensis] Length = 154 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/45 (62%), Positives = 30/45 (66%) Frame = -2 Query: 189 LQSKGVEYYARICGLKREDVLPCFLFVEGPGSYLQVSAGVSTGAT 55 LQS+ E Y R+CGL REDVL FLFVEGPG Y Q S G G T Sbjct: 103 LQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTGGGWGIT 147 >gb|KDO82584.1| hypothetical protein CISIN_1g028306mg [Citrus sinensis] Length = 163 Score = 53.9 bits (128), Expect = 7e-06 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = -2 Query: 189 LQSKGVEYYARICGLKREDVLPCFLFVEGPGSYLQVSAGV 70 LQS+ E Y R+CGL REDVL FLFVEGPG Y Q S G+ Sbjct: 103 LQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTGM 142