BLASTX nr result
ID: Rehmannia28_contig00025287
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00025287 (479 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096527.1| PREDICTED: mitochondrial inner membrane prot... 65 3e-10 ref|XP_012849084.1| PREDICTED: mitochondrial inner membrane prot... 53 8e-06 >ref|XP_011096527.1| PREDICTED: mitochondrial inner membrane protease subunit 1-like [Sesamum indicum] Length = 168 Score = 64.7 bits (156), Expect = 3e-10 Identities = 31/35 (88%), Positives = 31/35 (88%) Frame = -3 Query: 105 MGMNRLQELAPFVKEALQQTARVANLLCFLHVTNT 1 MGM RLQELAPFVKEAL QTARVAN LCFLHV NT Sbjct: 1 MGMERLQELAPFVKEALHQTARVANALCFLHVANT 35 >ref|XP_012849084.1| PREDICTED: mitochondrial inner membrane protease subunit 1-like [Erythranthe guttata] gi|848897972|ref|XP_012849086.1| PREDICTED: mitochondrial inner membrane protease subunit 1-like [Erythranthe guttata] gi|848897974|ref|XP_012849087.1| PREDICTED: mitochondrial inner membrane protease subunit 1-like [Erythranthe guttata] gi|604315486|gb|EYU28192.1| hypothetical protein MIMGU_mgv1a014597mg [Erythranthe guttata] Length = 184 Score = 53.1 bits (126), Expect = 8e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -3 Query: 114 KKKMGMNRLQELAPFVKEALQQTARVANLLCFLHVT 7 +++MGM RL+EL P VKEALQ TARVAN C LH T Sbjct: 12 EREMGMERLRELTPIVKEALQNTARVANFFCLLHFT 47