BLASTX nr result
ID: Rehmannia28_contig00025107
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00025107 (347 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012072366.1| PREDICTED: 54S ribosomal protein L24, mitoch... 54 2e-06 ref|XP_011081840.1| PREDICTED: uncharacterized protein LOC105164... 54 2e-06 ref|XP_012855923.1| PREDICTED: 54S ribosomal protein L24, mitoch... 52 7e-06 >ref|XP_012072366.1| PREDICTED: 54S ribosomal protein L24, mitochondrial [Jatropha curcas] gi|643730732|gb|KDP38164.1| hypothetical protein JCGZ_04807 [Jatropha curcas] Length = 211 Score = 53.9 bits (128), Expect = 2e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +2 Query: 242 LKKSVADNKVIMGQAQRGLVACRQIQFGSRVSEDG 346 LKKS+ D+KV+MG+A+RGL A R IQFG+RVSEDG Sbjct: 29 LKKSIPDSKVVMGRAKRGLFAGRHIQFGNRVSEDG 63 >ref|XP_011081840.1| PREDICTED: uncharacterized protein LOC105164778 [Sesamum indicum] Length = 220 Score = 53.9 bits (128), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +2 Query: 242 LKKSVADNKVIMGQAQRGLVACRQIQFGSRVSEDG 346 LKKSV D+KV+MG+A RGL A R IQFG+RVSEDG Sbjct: 30 LKKSVPDSKVVMGRAHRGLYAGRHIQFGNRVSEDG 64 >ref|XP_012855923.1| PREDICTED: 54S ribosomal protein L24, mitochondrial [Erythranthe guttata] gi|604302312|gb|EYU21888.1| hypothetical protein MIMGU_mgv1a013655mg [Erythranthe guttata] Length = 214 Score = 52.4 bits (124), Expect = 7e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +2 Query: 242 LKKSVADNKVIMGQAQRGLVACRQIQFGSRVSEDG 346 LKK++ D++V+MG+AQRGL A R IQFG+RVSEDG Sbjct: 30 LKKAMPDSRVVMGRAQRGLFAGRHIQFGNRVSEDG 64