BLASTX nr result
ID: Rehmannia28_contig00024991
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00024991 (388 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011092870.1| PREDICTED: 5'-methylthioadenosine/S-adenosyl... 77 1e-14 ref|XP_012839340.1| PREDICTED: 5'-methylthioadenosine/S-adenosyl... 72 1e-12 ref|XP_011088512.1| PREDICTED: 5'-methylthioadenosine/S-adenosyl... 67 1e-10 >ref|XP_011092870.1| PREDICTED: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase 1-like [Sesamum indicum] Length = 264 Score = 77.0 bits (188), Expect = 1e-14 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = -2 Query: 144 MAPPNDDNTAAEVDEDPTPKRHISSILFVIAMQAEASPLVNKFQLAEE 1 MAPP+DD AAEV++D TPKR IS++LF+IAMQ EASPLVNKFQL EE Sbjct: 1 MAPPHDDKAAAEVNDDSTPKRPISNVLFIIAMQTEASPLVNKFQLVEE 48 >ref|XP_012839340.1| PREDICTED: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase 2-like [Erythranthe guttata] gi|604330901|gb|EYU35802.1| hypothetical protein MIMGU_mgv1a011991mg [Erythranthe guttata] Length = 264 Score = 72.0 bits (175), Expect = 1e-12 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = -2 Query: 144 MAPPNDDNTAAEVDEDPTPKRHISSILFVIAMQAEASPLVNKFQLAEE 1 MAPP+DD AAEV+++ PKR IS+ILF+IAMQ EASPLV+KFQLAE+ Sbjct: 1 MAPPHDDKAAAEVNDEQIPKRPISNILFIIAMQTEASPLVDKFQLAED 48 >ref|XP_011088512.1| PREDICTED: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase 1-like [Sesamum indicum] gi|747082389|ref|XP_011088513.1| PREDICTED: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase 1-like [Sesamum indicum] gi|747082391|ref|XP_011088514.1| PREDICTED: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase 1-like [Sesamum indicum] Length = 264 Score = 66.6 bits (161), Expect = 1e-10 Identities = 32/48 (66%), Positives = 40/48 (83%) Frame = -2 Query: 144 MAPPNDDNTAAEVDEDPTPKRHISSILFVIAMQAEASPLVNKFQLAEE 1 MAPP D A++V+++ TPKR ISS+LFVIAMQ EA PLV+KFQLAE+ Sbjct: 1 MAPPPGDKKASKVNQESTPKRSISSVLFVIAMQTEALPLVDKFQLAEQ 48