BLASTX nr result
ID: Rehmannia28_contig00024298
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00024298 (718 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012836158.1| PREDICTED: HVA22-like protein j [Erythranthe... 96 4e-21 ref|XP_012828691.1| PREDICTED: putative HVA22-like protein g [Er... 78 1e-13 ref|XP_011094253.1| PREDICTED: putative HVA22-like protein g [Se... 76 4e-13 >ref|XP_012836158.1| PREDICTED: HVA22-like protein j [Erythranthe guttata] Length = 183 Score = 95.9 bits (237), Expect = 4e-21 Identities = 48/68 (70%), Positives = 54/68 (79%) Frame = -2 Query: 468 GIFKRNKSDKRRPPIPPPGSSTSHLSQTPRSDSFKVQLHNQTRFIHPEDILIPDPNIDSR 289 GIFKR KSDKRRPP+PP S SH SQTP+SDS KVQL +QT+FIH EDILIPD NI + Sbjct: 103 GIFKRTKSDKRRPPVPP---SPSHRSQTPKSDSTKVQLRSQTQFIHTEDILIPDSNIGIK 159 Query: 288 LEEKSDGD 265 LE KSD + Sbjct: 160 LEAKSDSE 167 >ref|XP_012828691.1| PREDICTED: putative HVA22-like protein g [Erythranthe guttata] Length = 262 Score = 77.8 bits (190), Expect = 1e-13 Identities = 36/69 (52%), Positives = 49/69 (71%) Frame = -2 Query: 468 GIFKRNKSDKRRPPIPPPGSSTSHLSQTPRSDSFKVQLHNQTRFIHPEDILIPDPNIDSR 289 G+F+ + ++ PP P ++T H + TP+S+S KV+L NQT FI PED+LIPD NI S+ Sbjct: 178 GLFRWSSKRRQSPPAGP--ATTHHRNYTPKSESIKVELQNQTHFIRPEDVLIPDSNIGSK 235 Query: 288 LEEKSDGDH 262 L EKSD DH Sbjct: 236 LREKSDADH 244 >ref|XP_011094253.1| PREDICTED: putative HVA22-like protein g [Sesamum indicum] Length = 257 Score = 76.3 bits (186), Expect = 4e-13 Identities = 42/74 (56%), Positives = 52/74 (70%), Gaps = 3/74 (4%) Frame = -2 Query: 468 GIFKRNKSDKRRPPIPPPGSSTSHLSQTPRSDSFKVQLHNQTRFIHPEDILIPDPNIDSR 289 GIFKRN +DKRRP P G STSH SQT +S++ KV+L ++T+FI PEDIL+P +I Sbjct: 174 GIFKRN-NDKRRPASPRSGPSTSHRSQTAKSEAIKVELDSKTQFIRPEDILVPGSDICGG 232 Query: 288 LEEKSDGD---HAA 256 EEKS D HAA Sbjct: 233 SEEKSGADRELHAA 246