BLASTX nr result
ID: Rehmannia28_contig00024127
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00024127 (720 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099401.1| PREDICTED: uncharacterized protein LOC105177... 70 1e-11 ref|XP_012855634.1| PREDICTED: uncharacterized protein LOC105975... 63 6e-09 >ref|XP_011099401.1| PREDICTED: uncharacterized protein LOC105177838 [Sesamum indicum] Length = 155 Score = 70.1 bits (170), Expect = 1e-11 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -3 Query: 640 RSNTVAFGRIDEEKSFEYGEEDDVGLLGGINYPRTRSYAVPRRIKV 503 RS+TVAFGRIDE+++ E+G+E+DVGLLGG YPR+RSYAV RR KV Sbjct: 109 RSHTVAFGRIDEDRAVEFGDEEDVGLLGGGAYPRSRSYAVLRRSKV 154 >ref|XP_012855634.1| PREDICTED: uncharacterized protein LOC105975011 [Erythranthe guttata] Length = 170 Score = 63.2 bits (152), Expect = 6e-09 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 3/70 (4%) Frame = -3 Query: 712 ELHRSRSAIPFXXXXXXXXXXXVPRSNTVAFGRIDEEKSF-EYGEEDDVGLLGG--INYP 542 EL RS+S+ P VPRSNTV FGRIDE++SF ++GEED GLLGG +P Sbjct: 97 ELRRSKSSFPLGAAAADGGVAVVPRSNTVGFGRIDEDRSFHDFGEEDKRGLLGGGSNEFP 156 Query: 541 RTRSYAVPRR 512 R+RS+A R Sbjct: 157 RSRSHAAASR 166