BLASTX nr result
ID: Rehmannia28_contig00024089
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00024089 (309 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073443.1| PREDICTED: ATP-dependent RNA helicase SUPV3L... 74 2e-13 ref|XP_012841751.1| PREDICTED: ATP-dependent RNA helicase SUV3, ... 68 2e-11 emb|CDO99089.1| unnamed protein product [Coffea canephora] 62 3e-09 ref|XP_010326677.1| PREDICTED: ATP-dependent RNA helicase SUPV3L... 61 6e-09 ref|XP_015088189.1| PREDICTED: ATP-dependent RNA helicase SUV3, ... 61 6e-09 ref|XP_006360763.1| PREDICTED: ATP-dependent RNA helicase SUV3, ... 61 6e-09 ref|XP_004247583.1| PREDICTED: ATP-dependent RNA helicase SUPV3L... 61 6e-09 gb|EPS66047.1| hypothetical protein M569_08726, partial [Genlise... 57 2e-07 ref|XP_009800791.1| PREDICTED: ATP-dependent RNA helicase SUPV3L... 55 4e-07 ref|XP_007034823.1| ATP-dependent RNA helicase, mitochondrial (S... 56 5e-07 ref|XP_007034819.1| ATP-dependent RNA and DNA helicase, putative... 56 5e-07 ref|XP_007034822.1| ATP-dependent RNA and DNA helicase, putative... 56 5e-07 gb|KVH97362.1| Helicase, C-terminal [Cynara cardunculus var. sco... 55 7e-07 >ref|XP_011073443.1| PREDICTED: ATP-dependent RNA helicase SUPV3L1, mitochondrial [Sesamum indicum] Length = 548 Score = 73.9 bits (180), Expect = 2e-13 Identities = 32/49 (65%), Positives = 36/49 (73%) Frame = +1 Query: 160 DNADISRSSWQFKFGTSYGVYQCLRKLSSSTGAKKFDFTDLTRPHTWYP 306 DN +W K GTS+ V +CLRK+SSS G KKFDFTDLTRPHTWYP Sbjct: 17 DNVGCYYYTWDSKLGTSWSVCRCLRKISSSVGGKKFDFTDLTRPHTWYP 65 >ref|XP_012841751.1| PREDICTED: ATP-dependent RNA helicase SUV3, mitochondrial [Erythranthe guttata] gi|604347417|gb|EYU45669.1| hypothetical protein MIMGU_mgv1a004052mg [Erythranthe guttata] Length = 547 Score = 68.2 bits (165), Expect = 2e-11 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 196 KFGTSYGVYQCLRKLSSSTGAKKFDFTDLTRPHTWYP 306 KFGTSYGVYQCLR SS +G KK+DFTDLT PH WYP Sbjct: 21 KFGTSYGVYQCLRNASSYSGPKKYDFTDLTCPHKWYP 57 >emb|CDO99089.1| unnamed protein product [Coffea canephora] Length = 627 Score = 62.4 bits (150), Expect = 3e-09 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 208 SYGVYQCLRKLSSSTGAKKFDFTDLTRPHTWYPN 309 S+G+ C R+LSSS AKKFDFTDLTRPHTWYPN Sbjct: 38 SFGICNCFRQLSSSGDAKKFDFTDLTRPHTWYPN 71 >ref|XP_010326677.1| PREDICTED: ATP-dependent RNA helicase SUPV3L1, mitochondrial isoform X2 [Solanum lycopersicum] Length = 536 Score = 61.2 bits (147), Expect = 6e-09 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 208 SYGVYQCLRKLSSSTGAKKFDFTDLTRPHTWYPN 309 S+G+ CLRK SSST A+K DFTDLTRPHTWYP+ Sbjct: 6 SFGICNCLRKFSSSTAARKVDFTDLTRPHTWYPH 39 >ref|XP_015088189.1| PREDICTED: ATP-dependent RNA helicase SUV3, mitochondrial [Solanum pennellii] Length = 569 Score = 61.2 bits (147), Expect = 6e-09 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 208 SYGVYQCLRKLSSSTGAKKFDFTDLTRPHTWYPN 309 S+G+ CLRK SSST A+K DFTDLTRPHTWYP+ Sbjct: 39 SFGICNCLRKFSSSTAARKVDFTDLTRPHTWYPH 72 >ref|XP_006360763.1| PREDICTED: ATP-dependent RNA helicase SUV3, mitochondrial isoform X1 [Solanum tuberosum] Length = 569 Score = 61.2 bits (147), Expect = 6e-09 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 208 SYGVYQCLRKLSSSTGAKKFDFTDLTRPHTWYPN 309 S+G+ CLRK SSST A+K DFTDLTRPHTWYP+ Sbjct: 39 SFGICNCLRKFSSSTAARKVDFTDLTRPHTWYPH 72 >ref|XP_004247583.1| PREDICTED: ATP-dependent RNA helicase SUPV3L1, mitochondrial isoform X1 [Solanum lycopersicum] Length = 569 Score = 61.2 bits (147), Expect = 6e-09 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 208 SYGVYQCLRKLSSSTGAKKFDFTDLTRPHTWYPN 309 S+G+ CLRK SSST A+K DFTDLTRPHTWYP+ Sbjct: 39 SFGICNCLRKFSSSTAARKVDFTDLTRPHTWYPH 72 >gb|EPS66047.1| hypothetical protein M569_08726, partial [Genlisea aurea] Length = 542 Score = 57.0 bits (136), Expect = 2e-07 Identities = 26/49 (53%), Positives = 32/49 (65%) Frame = +1 Query: 160 DNADISRSSWQFKFGTSYGVYQCLRKLSSSTGAKKFDFTDLTRPHTWYP 306 DN + + K +S+G QCLR+LSS + A K DFTDLT PHTWYP Sbjct: 9 DNEVLYLPNLGLKLVSSFGASQCLRQLSSCSAANKVDFTDLTSPHTWYP 57 >ref|XP_009800791.1| PREDICTED: ATP-dependent RNA helicase SUPV3L1, mitochondrial-like [Nicotiana sylvestris] Length = 172 Score = 54.7 bits (130), Expect = 4e-07 Identities = 21/41 (51%), Positives = 28/41 (68%) Frame = +1 Query: 187 WQFKFGTSYGVYQCLRKLSSSTGAKKFDFTDLTRPHTWYPN 309 W S+ + CLR+ S+ST A+K DFTDLT PH+WYP+ Sbjct: 33 WNMGTEASFAICNCLRQFSNSTAARKVDFTDLTHPHSWYPH 73 >ref|XP_007034823.1| ATP-dependent RNA helicase, mitochondrial (SUV3) isoform 5 [Theobroma cacao] gi|508713852|gb|EOY05749.1| ATP-dependent RNA helicase, mitochondrial (SUV3) isoform 5 [Theobroma cacao] Length = 412 Score = 55.8 bits (133), Expect = 5e-07 Identities = 27/50 (54%), Positives = 30/50 (60%) Frame = +1 Query: 160 DNADISRSSWQFKFGTSYGVYQCLRKLSSSTGAKKFDFTDLTRPHTWYPN 309 DN D R + KF T + +RK SS A KFDFTDLT PHTWYPN Sbjct: 22 DNGDSFRLRLESKFETFASIGVMIRKYSSGKSAAKFDFTDLTCPHTWYPN 71 >ref|XP_007034819.1| ATP-dependent RNA and DNA helicase, putative isoform 1 [Theobroma cacao] gi|508713848|gb|EOY05745.1| ATP-dependent RNA and DNA helicase, putative isoform 1 [Theobroma cacao] Length = 570 Score = 55.8 bits (133), Expect = 5e-07 Identities = 27/50 (54%), Positives = 30/50 (60%) Frame = +1 Query: 160 DNADISRSSWQFKFGTSYGVYQCLRKLSSSTGAKKFDFTDLTRPHTWYPN 309 DN D R + KF T + +RK SS A KFDFTDLT PHTWYPN Sbjct: 22 DNGDSFRLRLESKFETFASIGVMIRKYSSGKSAAKFDFTDLTCPHTWYPN 71 >ref|XP_007034822.1| ATP-dependent RNA and DNA helicase, putative isoform 4 [Theobroma cacao] gi|508713851|gb|EOY05748.1| ATP-dependent RNA and DNA helicase, putative isoform 4 [Theobroma cacao] Length = 571 Score = 55.8 bits (133), Expect = 5e-07 Identities = 27/50 (54%), Positives = 30/50 (60%) Frame = +1 Query: 160 DNADISRSSWQFKFGTSYGVYQCLRKLSSSTGAKKFDFTDLTRPHTWYPN 309 DN D R + KF T + +RK SS A KFDFTDLT PHTWYPN Sbjct: 22 DNGDSFRLRLESKFETFASIGVMIRKYSSGKSAAKFDFTDLTCPHTWYPN 71 >gb|KVH97362.1| Helicase, C-terminal [Cynara cardunculus var. scolymus] Length = 565 Score = 55.5 bits (132), Expect = 7e-07 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = +1 Query: 187 WQFKFGTSYGVYQCLRKLSSSTGAKKFDFTDLTRPHTWYP 306 W G S ++ R+ SSSTGA K DFTDLTRPHTWYP Sbjct: 42 WDLTCGASARIHVSSRQFSSSTGAVKMDFTDLTRPHTWYP 81