BLASTX nr result
ID: Rehmannia28_contig00023889
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00023889 (501 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076119.1| PREDICTED: uncharacterized protein LOC105160... 48 9e-09 >ref|XP_011076119.1| PREDICTED: uncharacterized protein LOC105160446 [Sesamum indicum] gi|747059472|ref|XP_011076120.1| PREDICTED: uncharacterized protein LOC105160446 [Sesamum indicum] Length = 1183 Score = 47.8 bits (112), Expect(2) = 9e-09 Identities = 21/37 (56%), Positives = 26/37 (70%) Frame = -1 Query: 501 RRDDSFKPLQRALDSDGGGNMRQYRHNTVDDFEMSEL 391 RRDDS + + R L SD GGN+R++RH DDFE S L Sbjct: 1118 RRDDSSEVMHRGLHSDEGGNVRRFRHTAADDFETSNL 1154 Score = 38.5 bits (88), Expect(2) = 9e-09 Identities = 19/32 (59%), Positives = 23/32 (71%), Gaps = 8/32 (25%) Frame = -2 Query: 398 ANLNNEDDVRVTDTRDIP--------KRAFKI 327 +NLNN+DDVRVTD RD+P KRA+KI Sbjct: 1152 SNLNNDDDVRVTDPRDVPQTQGDREDKRAYKI 1183