BLASTX nr result
ID: Rehmannia28_contig00023786
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00023786 (394 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012830462.1| PREDICTED: probable LRR receptor-like serine... 60 6e-08 >ref|XP_012830462.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase MRH1 [Erythranthe guttata] Length = 714 Score = 59.7 bits (143), Expect = 6e-08 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = +2 Query: 269 MVRQAMNSRWTVYGAQLSCFAFFILVLGIHGCCCPLNSEG 388 MVRQ M+ RW YGA SCF F +LVLGIHG CC L+SEG Sbjct: 1 MVRQTMSRRWIAYGAHFSCFVFSVLVLGIHG-CCTLDSEG 39