BLASTX nr result
ID: Rehmannia28_contig00023750
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00023750 (440 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075110.1| PREDICTED: uncharacterized protein LOC105159... 96 1e-20 gb|EYU27645.1| hypothetical protein MIMGU_mgv1a004828mg [Erythra... 79 2e-14 ref|XP_012848858.1| PREDICTED: uncharacterized protein LOC105968... 79 2e-14 ref|XP_007050704.1| Mitochondrial transcription termination fact... 54 9e-06 ref|XP_012473962.1| PREDICTED: uncharacterized protein LOC105790... 54 9e-06 gb|KHG20785.1| Mterfd1 [Gossypium arboreum] 54 9e-06 gb|KHG20784.1| Mterfd1 [Gossypium arboreum] 54 9e-06 >ref|XP_011075110.1| PREDICTED: uncharacterized protein LOC105159670 [Sesamum indicum] gi|747057605|ref|XP_011075111.1| PREDICTED: uncharacterized protein LOC105159670 [Sesamum indicum] gi|747057607|ref|XP_011075113.1| PREDICTED: uncharacterized protein LOC105159670 [Sesamum indicum] Length = 524 Score = 96.3 bits (238), Expect = 1e-20 Identities = 45/55 (81%), Positives = 51/55 (92%) Frame = +3 Query: 276 MKITSCSGLAKPSFLLVHYELPAFAFHRPQLISITSLYTSSNCKKRCGLVMKLHS 440 MK+TS +GLAKPSFLLVHYELPAFAFHR Q++SI+SL SSNCKKRCGLVMKL+S Sbjct: 1 MKVTSYTGLAKPSFLLVHYELPAFAFHRSQMVSISSLCVSSNCKKRCGLVMKLYS 55 >gb|EYU27645.1| hypothetical protein MIMGU_mgv1a004828mg [Erythranthe guttata] gi|604314940|gb|EYU27646.1| hypothetical protein MIMGU_mgv1a004828mg [Erythranthe guttata] Length = 508 Score = 78.6 bits (192), Expect = 2e-14 Identities = 39/55 (70%), Positives = 42/55 (76%) Frame = +3 Query: 276 MKITSCSGLAKPSFLLVHYELPAFAFHRPQLISITSLYTSSNCKKRCGLVMKLHS 440 MKI S +G+AKP FLLVHYE PAFAFHR QLISI S+ S KK C LVMKLHS Sbjct: 1 MKIASYAGVAKPGFLLVHYEFPAFAFHRNQLISIPSICAPSKYKKPCSLVMKLHS 55 >ref|XP_012848858.1| PREDICTED: uncharacterized protein LOC105968744 [Erythranthe guttata] Length = 524 Score = 78.6 bits (192), Expect = 2e-14 Identities = 39/55 (70%), Positives = 42/55 (76%) Frame = +3 Query: 276 MKITSCSGLAKPSFLLVHYELPAFAFHRPQLISITSLYTSSNCKKRCGLVMKLHS 440 MKI S +G+AKP FLLVHYE PAFAFHR QLISI S+ S KK C LVMKLHS Sbjct: 1 MKIASYAGVAKPGFLLVHYEFPAFAFHRNQLISIPSICAPSKYKKPCSLVMKLHS 55 >ref|XP_007050704.1| Mitochondrial transcription termination factor family protein isoform 1 [Theobroma cacao] gi|590717915|ref|XP_007050705.1| Mitochondrial transcription termination factor family protein isoform 1 [Theobroma cacao] gi|508702965|gb|EOX94861.1| Mitochondrial transcription termination factor family protein isoform 1 [Theobroma cacao] gi|508702966|gb|EOX94862.1| Mitochondrial transcription termination factor family protein isoform 1 [Theobroma cacao] Length = 523 Score = 53.9 bits (128), Expect = 9e-06 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = +3 Query: 276 MKITSCSGLAKPSFLLVHYELPAFAFHRPQLISITSLYTSSNCKKRCGLVMKL 434 MKI S +G+ KPSFLLVH ELPA FH+P+L ++L N ++ GL+ ++ Sbjct: 1 MKIRSYAGITKPSFLLVHSELPALTFHKPKLTWTSTLRIPRNYERNFGLIARV 53 >ref|XP_012473962.1| PREDICTED: uncharacterized protein LOC105790761 [Gossypium raimondii] gi|823148110|ref|XP_012473963.1| PREDICTED: uncharacterized protein LOC105790761 [Gossypium raimondii] gi|763755823|gb|KJB23154.1| hypothetical protein B456_004G084100 [Gossypium raimondii] gi|763755824|gb|KJB23155.1| hypothetical protein B456_004G084100 [Gossypium raimondii] gi|763755825|gb|KJB23156.1| hypothetical protein B456_004G084100 [Gossypium raimondii] Length = 524 Score = 53.9 bits (128), Expect = 9e-06 Identities = 26/54 (48%), Positives = 34/54 (62%) Frame = +3 Query: 276 MKITSCSGLAKPSFLLVHYELPAFAFHRPQLISITSLYTSSNCKKRCGLVMKLH 437 MKI SC G+ KPS LLVH ELPA FH+ +L ++L SN ++ G V + H Sbjct: 1 MKIRSCVGITKPSLLLVHSELPALTFHKTKLTWTSTLRFPSNYERTSGSVTRFH 54 >gb|KHG20785.1| Mterfd1 [Gossypium arboreum] Length = 524 Score = 53.9 bits (128), Expect = 9e-06 Identities = 26/54 (48%), Positives = 34/54 (62%) Frame = +3 Query: 276 MKITSCSGLAKPSFLLVHYELPAFAFHRPQLISITSLYTSSNCKKRCGLVMKLH 437 MKI SC G+ KPS LLVH ELPA FH+ +L ++L SN ++ G V + H Sbjct: 1 MKIRSCVGITKPSLLLVHSELPALTFHKTKLTWTSTLRFPSNYERTSGSVTRFH 54 >gb|KHG20784.1| Mterfd1 [Gossypium arboreum] Length = 528 Score = 53.9 bits (128), Expect = 9e-06 Identities = 26/54 (48%), Positives = 34/54 (62%) Frame = +3 Query: 276 MKITSCSGLAKPSFLLVHYELPAFAFHRPQLISITSLYTSSNCKKRCGLVMKLH 437 MKI SC G+ KPS LLVH ELPA FH+ +L ++L SN ++ G V + H Sbjct: 1 MKIRSCVGITKPSLLLVHSELPALTFHKTKLTWTSTLRFPSNYERTSGSVTRFH 54