BLASTX nr result
ID: Rehmannia28_contig00023604
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00023604 (363 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010246727.1| PREDICTED: phosphatidylinositol 4-phosphate ... 84 1e-16 ref|XP_010272887.1| PREDICTED: phosphatidylinositol 4-phosphate ... 82 5e-16 ref|XP_006838377.1| PREDICTED: phosphatidylinositol 4-phosphate ... 82 8e-16 ref|XP_012446760.1| PREDICTED: phosphatidylinositol 4-phosphate ... 82 8e-16 gb|KHG26589.1| Phosphatidylinositol-4-phosphate 5-kinase 1 -like... 82 8e-16 emb|CDP12435.1| unnamed protein product [Coffea canephora] 82 8e-16 ref|XP_015944819.1| PREDICTED: phosphatidylinositol 4-phosphate ... 82 8e-16 ref|XP_008465818.1| PREDICTED: phosphatidylinositol 4-phosphate ... 82 8e-16 ref|XP_004140328.1| PREDICTED: phosphatidylinositol 4-phosphate ... 82 8e-16 ref|XP_013461615.1| phosphatidylinositol-4-phosphate 5-kinase fa... 81 1e-15 ref|XP_004503007.1| PREDICTED: phosphatidylinositol 4-phosphate ... 81 1e-15 ref|XP_004290830.1| PREDICTED: phosphatidylinositol 4-phosphate ... 81 1e-15 ref|XP_006384400.1| hypothetical protein POPTR_0004s14700g [Popu... 81 2e-15 ref|XP_011011335.1| PREDICTED: phosphatidylinositol 4-phosphate ... 81 2e-15 ref|XP_011015918.1| PREDICTED: phosphatidylinositol 4-phosphate ... 81 2e-15 ref|XP_011001289.1| PREDICTED: phosphatidylinositol 4-phosphate ... 81 2e-15 ref|XP_002325695.2| hypothetical protein POPTR_0019s01150g [Popu... 81 2e-15 ref|XP_015955783.1| PREDICTED: phosphatidylinositol 4-phosphate ... 80 2e-15 ref|XP_010095887.1| Phosphatidylinositol-4-phosphate 5-kinase 1 ... 80 2e-15 gb|KVH99445.1| MORN motif-containing protein [Cynara cardunculus... 80 2e-15 >ref|XP_010246727.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Nelumbo nucifera] Length = 788 Score = 84.0 bits (206), Expect = 1e-16 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -3 Query: 361 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVRRIFVEDR 239 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDF+RRIF+EDR Sbjct: 748 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFIRRIFIEDR 788 >ref|XP_010272887.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Nelumbo nucifera] Length = 787 Score = 82.4 bits (202), Expect = 5e-16 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -3 Query: 361 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVRRIFVEDR 239 KKLEHAYKSLQ DPTSISAVDPKLYSKRFRDF+RRIF+EDR Sbjct: 747 KKLEHAYKSLQADPTSISAVDPKLYSKRFRDFIRRIFIEDR 787 >ref|XP_006838377.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1 [Amborella trichopoda] gi|548840883|gb|ERN00946.1| hypothetical protein AMTR_s00002p00056060 [Amborella trichopoda] Length = 695 Score = 81.6 bits (200), Expect = 8e-16 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -3 Query: 361 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVRRIFVEDR 239 KKLEHAYKS QVDPTSISAVDPKLYSKRFRDFVRR+FVED+ Sbjct: 655 KKLEHAYKSFQVDPTSISAVDPKLYSKRFRDFVRRVFVEDK 695 >ref|XP_012446760.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Gossypium raimondii] gi|763792968|gb|KJB59964.1| hypothetical protein B456_009G283000 [Gossypium raimondii] Length = 729 Score = 81.6 bits (200), Expect = 8e-16 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 361 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVRRIFVEDR 239 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDF+ RIFVEDR Sbjct: 689 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFIGRIFVEDR 729 >gb|KHG26589.1| Phosphatidylinositol-4-phosphate 5-kinase 1 -like protein [Gossypium arboreum] Length = 729 Score = 81.6 bits (200), Expect = 8e-16 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 361 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVRRIFVEDR 239 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDF+ RIFVEDR Sbjct: 689 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFIGRIFVEDR 729 >emb|CDP12435.1| unnamed protein product [Coffea canephora] Length = 747 Score = 81.6 bits (200), Expect = 8e-16 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 361 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVRRIFVEDR 239 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDF+ RIFVEDR Sbjct: 707 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFIGRIFVEDR 747 >ref|XP_015944819.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 2-like [Arachis duranensis] Length = 750 Score = 81.6 bits (200), Expect = 8e-16 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 361 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVRRIFVEDR 239 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDF+ RIFVEDR Sbjct: 710 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFIGRIFVEDR 750 >ref|XP_008465818.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1 [Cucumis melo] Length = 786 Score = 81.6 bits (200), Expect = 8e-16 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 361 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVRRIFVEDR 239 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFV RIF+EDR Sbjct: 746 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVGRIFIEDR 786 >ref|XP_004140328.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1 [Cucumis sativus] gi|700195797|gb|KGN50974.1| hypothetical protein Csa_5G381800 [Cucumis sativus] Length = 786 Score = 81.6 bits (200), Expect = 8e-16 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 361 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVRRIFVEDR 239 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFV RIF+EDR Sbjct: 746 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVGRIFIEDR 786 >ref|XP_013461615.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Medicago truncatula] gi|657395293|gb|KEH35650.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Medicago truncatula] Length = 705 Score = 81.3 bits (199), Expect = 1e-15 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -3 Query: 361 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVRRIFVEDR 239 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDF+ RIFVED+ Sbjct: 665 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFIHRIFVEDK 705 >ref|XP_004503007.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Cicer arietinum] Length = 712 Score = 81.3 bits (199), Expect = 1e-15 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -3 Query: 361 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVRRIFVEDR 239 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDF+ RIFVED+ Sbjct: 672 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFIHRIFVEDK 712 >ref|XP_004290830.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1 [Fragaria vesca subsp. vesca] Length = 768 Score = 81.3 bits (199), Expect = 1e-15 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -3 Query: 361 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVRRIFVEDR 239 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDF+ RIF+EDR Sbjct: 728 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFIGRIFIEDR 768 >ref|XP_006384400.1| hypothetical protein POPTR_0004s14700g [Populus trichocarpa] gi|550341016|gb|ERP62197.1| hypothetical protein POPTR_0004s14700g [Populus trichocarpa] Length = 741 Score = 80.9 bits (198), Expect = 2e-15 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -3 Query: 361 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVRRIFVEDR 239 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDF+ RIF+ED+ Sbjct: 701 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFIHRIFIEDK 741 >ref|XP_011011335.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like isoform X1 [Populus euphratica] Length = 745 Score = 80.9 bits (198), Expect = 2e-15 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -3 Query: 361 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVRRIFVEDR 239 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDF+ RIF+ED+ Sbjct: 705 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFIHRIFIEDK 745 >ref|XP_011015918.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Populus euphratica] Length = 747 Score = 80.9 bits (198), Expect = 2e-15 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -3 Query: 361 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVRRIFVEDR 239 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDF+ RIF+ED+ Sbjct: 707 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFIHRIFIEDK 747 >ref|XP_011001289.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like isoform X1 [Populus euphratica] Length = 747 Score = 80.9 bits (198), Expect = 2e-15 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -3 Query: 361 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVRRIFVEDR 239 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDF+ RIF+ED+ Sbjct: 707 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFIHRIFIEDK 747 >ref|XP_002325695.2| hypothetical protein POPTR_0019s01150g [Populus trichocarpa] gi|550316437|gb|EEF00077.2| hypothetical protein POPTR_0019s01150g [Populus trichocarpa] Length = 748 Score = 80.9 bits (198), Expect = 2e-15 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -3 Query: 361 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVRRIFVEDR 239 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDF+ RIF+ED+ Sbjct: 708 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFIHRIFIEDK 748 >ref|XP_015955783.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Arachis duranensis] Length = 741 Score = 80.5 bits (197), Expect = 2e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 361 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVRRIFVED 242 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDF+ RIFVED Sbjct: 701 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFIHRIFVED 740 >ref|XP_010095887.1| Phosphatidylinositol-4-phosphate 5-kinase 1 [Morus notabilis] gi|587873242|gb|EXB62437.1| Phosphatidylinositol-4-phosphate 5-kinase 1 [Morus notabilis] Length = 753 Score = 80.5 bits (197), Expect = 2e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 361 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVRRIFVED 242 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDF+ RIFVED Sbjct: 710 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFIHRIFVED 749 >gb|KVH99445.1| MORN motif-containing protein [Cynara cardunculus var. scolymus] Length = 768 Score = 80.5 bits (197), Expect = 2e-15 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -3 Query: 361 KKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVRRIFVEDR 239 KKLEHAYKSLQ DPTSISAVDPKLYSKRFRDFV RIFVEDR Sbjct: 728 KKLEHAYKSLQADPTSISAVDPKLYSKRFRDFVGRIFVEDR 768