BLASTX nr result
ID: Rehmannia28_contig00022942
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00022942 (735 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09734.1| hypothetical protein B456_001G161000, partial [Go... 114 1e-27 ref|YP_007516852.1| hypothetical protein GlmaxMp02 (mitochondrio... 101 4e-24 ref|YP_173477.1| hypothetical protein NitaMp140 [Nicotiana tabac... 61 1e-08 ref|NP_064104.1| orf110b gene product (mitochondrion) [Beta vulg... 56 9e-07 gb|KVH96909.1| hypothetical protein Ccrd_001000 [Cynara carduncu... 49 2e-06 >gb|KJB09734.1| hypothetical protein B456_001G161000, partial [Gossypium raimondii] Length = 244 Score = 114 bits (286), Expect = 1e-27 Identities = 58/66 (87%), Positives = 59/66 (89%) Frame = -1 Query: 735 CSNQLSYLNHFPKVCFLHRIAPYLTT*LVREKPLTNKNI*AFSLVRQAFEQLFQLPPNPP 556 CSNQLSYLNHFPKV FLHRIAPYLTT LVREKPLTN + FSLVRQAFEQLFQLPPN P Sbjct: 117 CSNQLSYLNHFPKVSFLHRIAPYLTTLLVREKPLTNM-LGLFSLVRQAFEQLFQLPPNLP 175 Query: 555 TCSRTE 538 TCSRTE Sbjct: 176 TCSRTE 181 Score = 101 bits (252), Expect = 1e-22 Identities = 49/53 (92%), Positives = 49/53 (92%) Frame = -3 Query: 412 DSTKRFFLSRNFARPFHFRAGGNGIRTHDTIFLYVDLANQCLKPLSHTSKLLI 254 DSTKRFFLSRNFA P FRAGGNGIRTHDTIFLYVDLANQCLKPLSH SKLLI Sbjct: 190 DSTKRFFLSRNFACPLDFRAGGNGIRTHDTIFLYVDLANQCLKPLSHPSKLLI 242 >ref|YP_007516852.1| hypothetical protein GlmaxMp02 (mitochondrion) [Glycine max] gi|403311585|gb|AFR34333.1| hypothetical protein GlmaxMp02 (mitochondrion) [Glycine max] Length = 104 Score = 101 bits (252), Expect = 4e-24 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = -2 Query: 227 GWLPEGLSDPINCLSRSALARVLFFYERDSIQICHSLGDAFFSMNSPPLNDEL 69 G LPEGLSDPINC+SRSALARVLF YERDSIQICHSLGDA FSMN+PPLNDEL Sbjct: 3 GRLPEGLSDPINCVSRSALARVLFLYERDSIQICHSLGDALFSMNTPPLNDEL 55 >ref|YP_173477.1| hypothetical protein NitaMp140 [Nicotiana tabacum] gi|56806642|dbj|BAD83543.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 116 Score = 61.2 bits (147), Expect = 1e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 735 CSNQLSYLNHFPKVCFLHRIAPYLTT 658 CSNQLSYLNHFPKVCFLHRIAPYLTT Sbjct: 91 CSNQLSYLNHFPKVCFLHRIAPYLTT 116 >ref|NP_064104.1| orf110b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435128|ref|YP_004222346.1| hypothetical protein BevumaM_p112 (mitochondrion) [Beta vulgaris subsp. maritima] gi|346683219|ref|YP_004842151.1| hypothetical protein BemaM_p107 (mitochondrion) [Beta macrocarpa] gi|9087354|dbj|BAA99498.1| orf110b (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|317905682|emb|CBJ14076.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] gi|319439861|emb|CBJ17566.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] gi|320148051|emb|CBJ20714.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] gi|345500137|emb|CBX24956.1| hypothetical protein (mitochondrion) [Beta macrocarpa] gi|384939116|emb|CBL51962.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 110 Score = 55.8 bits (133), Expect = 9e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 735 CSNQLSYLNHFPKVCFLHRIAPY 667 CSNQLSYLNHFPKVCFLHRIAPY Sbjct: 61 CSNQLSYLNHFPKVCFLHRIAPY 83 >gb|KVH96909.1| hypothetical protein Ccrd_001000 [Cynara cardunculus var. scolymus] Length = 156 Score = 48.9 bits (115), Expect(2) = 2e-06 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 417 DWTPPRGSFSHVISPAPFISVPE 349 DWTPPRGSFSHVISPA F SVPE Sbjct: 57 DWTPPRGSFSHVISPARFTSVPE 79 Score = 31.2 bits (69), Expect(2) = 2e-06 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -3 Query: 556 NMLKNREPSRDWT 518 NMLKNREP RDWT Sbjct: 47 NMLKNREPPRDWT 59