BLASTX nr result
ID: Rehmannia28_contig00022694
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00022694 (967 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094028.1| PREDICTED: microtubule-associated protein TO... 50 1e-10 ref|XP_012851264.1| PREDICTED: microtubule-associated protein TO... 50 6e-10 gb|EYU25762.1| hypothetical protein MIMGU_mgv1a001378mg [Erythra... 50 6e-10 emb|CDP14229.1| unnamed protein product [Coffea canephora] 48 2e-08 ref|XP_009618427.1| PREDICTED: microtubule-associated protein TO... 44 1e-07 ref|XP_006353762.1| PREDICTED: microtubule-associated protein TO... 44 1e-07 ref|XP_004243912.1| PREDICTED: microtubule-associated protein TO... 44 1e-07 ref|XP_004301389.2| PREDICTED: microtubule-associated protein TO... 42 1e-07 ref|XP_015080355.1| PREDICTED: microtubule-associated protein TO... 44 2e-07 gb|EPS66155.1| hypothetical protein M569_08622, partial [Genlise... 45 3e-07 ref|XP_009786275.1| PREDICTED: microtubule-associated protein TO... 41 5e-07 ref|XP_008223937.1| PREDICTED: microtubule-associated protein TO... 45 5e-07 ref|XP_011010267.1| PREDICTED: microtubule-associated protein TO... 43 3e-06 ref|XP_011019950.1| PREDICTED: microtubule-associated protein TO... 43 3e-06 ref|XP_009362031.1| PREDICTED: microtubule-associated protein TO... 43 4e-06 ref|XP_007224049.1| hypothetical protein PRUPE_ppa015228mg [Prun... 42 5e-06 ref|XP_015881725.1| PREDICTED: microtubule-associated protein TO... 40 7e-06 ref|XP_015881728.1| PREDICTED: microtubule-associated protein TO... 40 7e-06 ref|XP_015384423.1| PREDICTED: microtubule-associated protein TO... 40 9e-06 ref|XP_006453167.1| hypothetical protein CICLE_v10007456mg [Citr... 40 9e-06 >ref|XP_011094028.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Sesamum indicum] gi|747092516|ref|XP_011094029.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Sesamum indicum] gi|747092518|ref|XP_011094030.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Sesamum indicum] gi|747092520|ref|XP_011094031.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Sesamum indicum] gi|747092522|ref|XP_011094032.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Sesamum indicum] gi|747092524|ref|XP_011094033.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Sesamum indicum] Length = 829 Score = 49.7 bits (117), Expect(2) = 1e-10 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = +2 Query: 860 KLFCAAFGDIASYCAVCLASFHTSCIHCLESCRFDK 967 K CAA GDI S A CL S+ S I CLESCRFDK Sbjct: 248 KAACAALGDIGSCGAACLGSYRISSIRCLESCRFDK 283 Score = 45.1 bits (105), Expect(2) = 1e-10 Identities = 23/46 (50%), Positives = 29/46 (63%) Frame = +1 Query: 742 VIKLHTCLTSGWWYPTHSSLNNALISIQESLKNIDWAIRKAVLCSI 879 VI+L+ + P+HSSL AL SIQESLKN DW RKA ++ Sbjct: 209 VIELNRSIILAGGAPSHSSLTAALTSIQESLKNSDWVTRKAACAAL 254 >ref|XP_012851264.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Erythranthe guttata] gi|848902755|ref|XP_012851265.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Erythranthe guttata] gi|604311767|gb|EYU25761.1| hypothetical protein MIMGU_mgv1a001378mg [Erythranthe guttata] Length = 830 Score = 50.4 bits (119), Expect(2) = 6e-10 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = +2 Query: 860 KLFCAAFGDIASYCAVCLASFHTSCIHCLESCRFDK 967 K CAA GDIAS A CL S+ SCI LE+CRFDK Sbjct: 249 KAACAALGDIASCSAACLGSYRASCIRGLETCRFDK 284 Score = 42.0 bits (97), Expect(2) = 6e-10 Identities = 22/46 (47%), Positives = 29/46 (63%) Frame = +1 Query: 742 VIKLHTCLTSGWWYPTHSSLNNALISIQESLKNIDWAIRKAVLCSI 879 V++L+ + THSSL AL SIQESLK+ DWA RKA ++ Sbjct: 210 VVELNRSIILAGGTLTHSSLTAALTSIQESLKSSDWATRKAACAAL 255 >gb|EYU25762.1| hypothetical protein MIMGU_mgv1a001378mg [Erythranthe guttata] Length = 826 Score = 50.4 bits (119), Expect(2) = 6e-10 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = +2 Query: 860 KLFCAAFGDIASYCAVCLASFHTSCIHCLESCRFDK 967 K CAA GDIAS A CL S+ SCI LE+CRFDK Sbjct: 249 KAACAALGDIASCSAACLGSYRASCIRGLETCRFDK 284 Score = 42.0 bits (97), Expect(2) = 6e-10 Identities = 22/46 (47%), Positives = 29/46 (63%) Frame = +1 Query: 742 VIKLHTCLTSGWWYPTHSSLNNALISIQESLKNIDWAIRKAVLCSI 879 V++L+ + THSSL AL SIQESLK+ DWA RKA ++ Sbjct: 210 VVELNRSIILAGGTLTHSSLTAALTSIQESLKSSDWATRKAACAAL 255 >emb|CDP14229.1| unnamed protein product [Coffea canephora] Length = 763 Score = 47.8 bits (112), Expect(2) = 2e-08 Identities = 22/36 (61%), Positives = 24/36 (66%) Frame = +2 Query: 860 KLFCAAFGDIASYCAVCLASFHTSCIHCLESCRFDK 967 K AA GDIAS SF +SC+HCLESCRFDK Sbjct: 242 KAASAALGDIASNGGAFFGSFKSSCLHCLESCRFDK 277 Score = 39.7 bits (91), Expect(2) = 2e-08 Identities = 20/46 (43%), Positives = 28/46 (60%) Frame = +1 Query: 742 VIKLHTCLTSGWWYPTHSSLNNALISIQESLKNIDWAIRKAVLCSI 879 VI+L+ + THS L+ A+ SIQE+LKN DW RKA ++ Sbjct: 203 VIELNRSIIQAGGASTHSLLSAAIASIQEALKNSDWITRKAASAAL 248 >ref|XP_009618427.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Nicotiana tomentosiformis] gi|697128751|ref|XP_009618428.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Nicotiana tomentosiformis] gi|697128753|ref|XP_009618429.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Nicotiana tomentosiformis] Length = 839 Score = 43.5 bits (101), Expect(2) = 1e-07 Identities = 21/46 (45%), Positives = 30/46 (65%) Frame = +1 Query: 742 VIKLHTCLTSGWWYPTHSSLNNALISIQESLKNIDWAIRKAVLCSI 879 VI+L+ + THS+L+ A+ SIQE+LKN DWA RKA ++ Sbjct: 217 VIELNRSIIQAGGANTHSALSTAMASIQEALKNSDWATRKAACAAL 262 Score = 41.2 bits (95), Expect(2) = 1e-07 Identities = 20/36 (55%), Positives = 23/36 (63%) Frame = +2 Query: 860 KLFCAAFGDIASYCAVCLASFHTSCIHCLESCRFDK 967 K CAA GDIAS ++F +S I LESCRFDK Sbjct: 256 KAACAALGDIASTGGALFSAFKSSSIRSLESCRFDK 291 >ref|XP_006353762.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Solanum tuberosum] gi|971561461|ref|XP_015166945.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Solanum tuberosum] gi|971561464|ref|XP_015166946.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Solanum tuberosum] Length = 833 Score = 43.5 bits (101), Expect(2) = 1e-07 Identities = 21/46 (45%), Positives = 29/46 (63%) Frame = +1 Query: 742 VIKLHTCLTSGWWYPTHSSLNNALISIQESLKNIDWAIRKAVLCSI 879 VI+L+ + THS+L+ A+ SIQE LKN DWA RKA ++ Sbjct: 211 VIELNRSIIQAGGTSTHSALSTAMTSIQEGLKNSDWATRKAACAAL 256 Score = 41.2 bits (95), Expect(2) = 1e-07 Identities = 20/36 (55%), Positives = 23/36 (63%) Frame = +2 Query: 860 KLFCAAFGDIASYCAVCLASFHTSCIHCLESCRFDK 967 K CAA GDIAS ++F +S I LESCRFDK Sbjct: 250 KAACAALGDIASVGGAFFSAFKSSSIRTLESCRFDK 285 >ref|XP_004243912.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Solanum lycopersicum] gi|723716633|ref|XP_010323972.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Solanum lycopersicum] gi|723716636|ref|XP_010323973.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Solanum lycopersicum] gi|723716639|ref|XP_010323974.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Solanum lycopersicum] gi|723716642|ref|XP_010323975.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Solanum lycopersicum] gi|723716645|ref|XP_010323976.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Solanum lycopersicum] gi|723716648|ref|XP_010323977.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Solanum lycopersicum] Length = 833 Score = 43.5 bits (101), Expect(2) = 1e-07 Identities = 21/46 (45%), Positives = 29/46 (63%) Frame = +1 Query: 742 VIKLHTCLTSGWWYPTHSSLNNALISIQESLKNIDWAIRKAVLCSI 879 VI+L+ + THS+L+ A+ SIQE LKN DWA RKA ++ Sbjct: 211 VIELNRSIIQAGGASTHSALSTAMTSIQEGLKNSDWATRKAACAAL 256 Score = 41.2 bits (95), Expect(2) = 1e-07 Identities = 20/36 (55%), Positives = 23/36 (63%) Frame = +2 Query: 860 KLFCAAFGDIASYCAVCLASFHTSCIHCLESCRFDK 967 K CAA GDIAS ++F +S I LESCRFDK Sbjct: 250 KAACAALGDIASVGGAFFSAFKSSSIRTLESCRFDK 285 >ref|XP_004301389.2| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Fragaria vesca subsp. vesca] Length = 827 Score = 42.4 bits (98), Expect(2) = 1e-07 Identities = 21/46 (45%), Positives = 29/46 (63%) Frame = +1 Query: 742 VIKLHTCLTSGWWYPTHSSLNNALISIQESLKNIDWAIRKAVLCSI 879 VI+L+ + PT + L+ A+ SIQESLKN DWA RKA ++ Sbjct: 211 VIELNRSIIQAGGAPTQNMLSGAMASIQESLKNNDWATRKAACIAL 256 Score = 42.4 bits (98), Expect(2) = 1e-07 Identities = 21/36 (58%), Positives = 22/36 (61%) Frame = +2 Query: 860 KLFCAAFGDIASYCAVCLASFHTSCIHCLESCRFDK 967 K C A G+IAS L SF SCI LESCRFDK Sbjct: 250 KAACIALGEIASSGGSFLGSFKASCIRSLESCRFDK 285 >ref|XP_015080355.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Solanum pennellii] gi|970038040|ref|XP_015080356.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Solanum pennellii] gi|970038042|ref|XP_015080357.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Solanum pennellii] Length = 833 Score = 43.5 bits (101), Expect(2) = 2e-07 Identities = 21/46 (45%), Positives = 29/46 (63%) Frame = +1 Query: 742 VIKLHTCLTSGWWYPTHSSLNNALISIQESLKNIDWAIRKAVLCSI 879 VI+L+ + THS+L+ A+ SIQE LKN DWA RKA ++ Sbjct: 211 VIELNRSIIQAGGASTHSALSTAMTSIQEGLKNSDWATRKAACAAL 256 Score = 40.0 bits (92), Expect(2) = 2e-07 Identities = 20/36 (55%), Positives = 22/36 (61%) Frame = +2 Query: 860 KLFCAAFGDIASYCAVCLASFHTSCIHCLESCRFDK 967 K CAA GDIAS +F +S I LESCRFDK Sbjct: 250 KAACAALGDIASVGGAFFNAFKSSSIRTLESCRFDK 285 >gb|EPS66155.1| hypothetical protein M569_08622, partial [Genlisea aurea] Length = 789 Score = 44.7 bits (104), Expect(2) = 3e-07 Identities = 21/36 (58%), Positives = 25/36 (69%) Frame = +2 Query: 860 KLFCAAFGDIASYCAVCLASFHTSCIHCLESCRFDK 967 K C+A DIAS A L+S+ +SCI LESCRFDK Sbjct: 242 KAACSALADIASSGATFLSSYRSSCIRSLESCRFDK 277 Score = 38.5 bits (88), Expect(2) = 3e-07 Identities = 21/46 (45%), Positives = 29/46 (63%) Frame = +1 Query: 739 KVIKLHTCLTSGWWYPTHSSLNNALISIQESLKNIDWAIRKAVLCS 876 ++I+L+ + P SSL ++SIQESLK+ DW IRKA CS Sbjct: 202 ELIELNKSIILAGGAPAQSSLTAGVLSIQESLKSSDWKIRKAA-CS 246 >ref|XP_009786275.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Nicotiana sylvestris] gi|698478207|ref|XP_009786276.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Nicotiana sylvestris] Length = 839 Score = 41.2 bits (95), Expect(2) = 5e-07 Identities = 21/46 (45%), Positives = 29/46 (63%) Frame = +1 Query: 742 VIKLHTCLTSGWWYPTHSSLNNALISIQESLKNIDWAIRKAVLCSI 879 VI+L+ + THS+L+ A+ SIQE LKN DWA RKA ++ Sbjct: 217 VIELNRSIIQAGGANTHSALSIAMASIQEVLKNSDWATRKAACAAL 262 Score = 41.2 bits (95), Expect(2) = 5e-07 Identities = 20/36 (55%), Positives = 23/36 (63%) Frame = +2 Query: 860 KLFCAAFGDIASYCAVCLASFHTSCIHCLESCRFDK 967 K CAA GDIAS ++F +S I LESCRFDK Sbjct: 256 KAACAALGDIASTGGALFSAFKSSSIRSLESCRFDK 291 >ref|XP_008223937.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Prunus mume] Length = 828 Score = 45.1 bits (105), Expect(2) = 5e-07 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = +2 Query: 860 KLFCAAFGDIASYCAVCLASFHTSCIHCLESCRFDK 967 K C A G+IAS L SF SCIH LESCRFDK Sbjct: 247 KAACIALGEIASGGGSFLGSFKASCIHSLESCRFDK 282 Score = 37.4 bits (85), Expect(2) = 5e-07 Identities = 18/46 (39%), Positives = 28/46 (60%) Frame = +1 Query: 742 VIKLHTCLTSGWWYPTHSSLNNALISIQESLKNIDWAIRKAVLCSI 879 +I+L+ + PT + L+ A+ SIQESLK+ DW RKA ++ Sbjct: 208 IIELNRSIIQAGGAPTQNILSAAMASIQESLKSNDWTTRKAACIAL 253 >ref|XP_011010267.1| PREDICTED: microtubule-associated protein TORTIFOLIA1-like [Populus euphratica] Length = 831 Score = 42.7 bits (99), Expect(2) = 3e-06 Identities = 21/36 (58%), Positives = 22/36 (61%) Frame = +2 Query: 860 KLFCAAFGDIASYCAVCLASFHTSCIHCLESCRFDK 967 K AA G+IAS CL F SCI LESCRFDK Sbjct: 248 KAASAALGEIASSGGSCLGPFRASCIRYLESCRFDK 283 Score = 37.0 bits (84), Expect(2) = 3e-06 Identities = 18/45 (40%), Positives = 28/45 (62%) Frame = +1 Query: 745 IKLHTCLTSGWWYPTHSSLNNALISIQESLKNIDWAIRKAVLCSI 879 I+L+ + P+ + L+ A+ISIQE+LKN DW RKA ++ Sbjct: 210 IELNRSIILAGGAPSQNILSAAMISIQEALKNSDWTTRKAASAAL 254 >ref|XP_011019950.1| PREDICTED: microtubule-associated protein TORTIFOLIA1-like [Populus euphratica] Length = 831 Score = 42.7 bits (99), Expect(2) = 3e-06 Identities = 21/36 (58%), Positives = 22/36 (61%) Frame = +2 Query: 860 KLFCAAFGDIASYCAVCLASFHTSCIHCLESCRFDK 967 K AA G+IAS CL F SCI LESCRFDK Sbjct: 248 KAASAALGEIASSGGSCLGPFRASCIRYLESCRFDK 283 Score = 37.0 bits (84), Expect(2) = 3e-06 Identities = 18/45 (40%), Positives = 28/45 (62%) Frame = +1 Query: 745 IKLHTCLTSGWWYPTHSSLNNALISIQESLKNIDWAIRKAVLCSI 879 I+L+ + P+ + L+ A+ISIQE+LKN DW RKA ++ Sbjct: 210 IELNRSIILAGGAPSQNILSAAMISIQEALKNSDWTTRKAASAAL 254 >ref|XP_009362031.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 [Pyrus x bretschneideri] Length = 827 Score = 43.1 bits (100), Expect(2) = 4e-06 Identities = 21/36 (58%), Positives = 23/36 (63%) Frame = +2 Query: 860 KLFCAAFGDIASYCAVCLASFHTSCIHCLESCRFDK 967 K C A G+IAS A + SF SCI LESCRFDK Sbjct: 247 KAACIALGEIASSGASFMGSFKASCIRSLESCRFDK 282 Score = 36.2 bits (82), Expect(2) = 4e-06 Identities = 18/46 (39%), Positives = 27/46 (58%) Frame = +1 Query: 742 VIKLHTCLTSGWWYPTHSSLNNALISIQESLKNIDWAIRKAVLCSI 879 +I+L+ + PT + L A+ SIQESLK+ DW RKA ++ Sbjct: 208 IIELNRSIIQAGGAPTQNVLAAAMTSIQESLKSNDWTTRKAACIAL 253 >ref|XP_007224049.1| hypothetical protein PRUPE_ppa015228mg [Prunus persica] gi|462420985|gb|EMJ25248.1| hypothetical protein PRUPE_ppa015228mg [Prunus persica] Length = 811 Score = 41.6 bits (96), Expect(2) = 5e-06 Identities = 20/36 (55%), Positives = 22/36 (61%) Frame = +2 Query: 860 KLFCAAFGDIASYCAVCLASFHTSCIHCLESCRFDK 967 K C A G+IAS L SF SC+ LESCRFDK Sbjct: 247 KAACIALGEIASGGGSFLGSFKASCVRSLESCRFDK 282 Score = 37.4 bits (85), Expect(2) = 5e-06 Identities = 18/46 (39%), Positives = 28/46 (60%) Frame = +1 Query: 742 VIKLHTCLTSGWWYPTHSSLNNALISIQESLKNIDWAIRKAVLCSI 879 +I+L+ + PT + L+ A+ SIQESLK+ DW RKA ++ Sbjct: 208 IIELNRSIIQAGGAPTQNVLSAAMASIQESLKSNDWTTRKAACIAL 253 >ref|XP_015881725.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 isoform X1 [Ziziphus jujuba] gi|1009129363|ref|XP_015881726.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 isoform X1 [Ziziphus jujuba] gi|1009129365|ref|XP_015881727.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 isoform X1 [Ziziphus jujuba] Length = 839 Score = 40.0 bits (92), Expect(2) = 7e-06 Identities = 20/41 (48%), Positives = 27/41 (65%) Frame = +1 Query: 742 VIKLHTCLTSGWWYPTHSSLNNALISIQESLKNIDWAIRKA 864 VI+L+ + PT + L+ A+ SIQESLKN DW+ RKA Sbjct: 208 VIELNRSIIQAGGAPTRNVLSAAMASIQESLKNSDWSTRKA 248 Score = 38.5 bits (88), Expect(2) = 7e-06 Identities = 20/36 (55%), Positives = 21/36 (58%) Frame = +2 Query: 860 KLFCAAFGDIASYCAVCLASFHTSCIHCLESCRFDK 967 K A G+IAS L SF SCI LESCRFDK Sbjct: 247 KAASVALGEIASSGGSFLGSFKPSCIRSLESCRFDK 282 >ref|XP_015881728.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 isoform X2 [Ziziphus jujuba] Length = 832 Score = 40.0 bits (92), Expect(2) = 7e-06 Identities = 20/41 (48%), Positives = 27/41 (65%) Frame = +1 Query: 742 VIKLHTCLTSGWWYPTHSSLNNALISIQESLKNIDWAIRKA 864 VI+L+ + PT + L+ A+ SIQESLKN DW+ RKA Sbjct: 208 VIELNRSIIQAGGAPTRNVLSAAMASIQESLKNSDWSTRKA 248 Score = 38.5 bits (88), Expect(2) = 7e-06 Identities = 20/36 (55%), Positives = 21/36 (58%) Frame = +2 Query: 860 KLFCAAFGDIASYCAVCLASFHTSCIHCLESCRFDK 967 K A G+IAS L SF SCI LESCRFDK Sbjct: 247 KAASVALGEIASSGGSFLGSFKPSCIRSLESCRFDK 282 >ref|XP_015384423.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 isoform X1 [Citrus sinensis] Length = 847 Score = 39.7 bits (91), Expect(2) = 9e-06 Identities = 20/36 (55%), Positives = 21/36 (58%) Frame = +2 Query: 860 KLFCAAFGDIASYCAVCLASFHTSCIHCLESCRFDK 967 K A G+IAS L F SCIH LESCRFDK Sbjct: 248 KAASVALGEIASSGGSFLGIFKASCIHSLESCRFDK 283 Score = 38.5 bits (88), Expect(2) = 9e-06 Identities = 18/41 (43%), Positives = 28/41 (68%) Frame = +1 Query: 742 VIKLHTCLTSGWWYPTHSSLNNALISIQESLKNIDWAIRKA 864 VI+L+ + T ++L+ A++SIQ++LKN DWA RKA Sbjct: 209 VIELNRSIIQAGGAATQNALSAAMVSIQDALKNSDWATRKA 249 >ref|XP_006453167.1| hypothetical protein CICLE_v10007456mg [Citrus clementina] gi|568840779|ref|XP_006474343.1| PREDICTED: microtubule-associated protein TORTIFOLIA1 isoform X2 [Citrus sinensis] gi|557556393|gb|ESR66407.1| hypothetical protein CICLE_v10007456mg [Citrus clementina] Length = 830 Score = 39.7 bits (91), Expect(2) = 9e-06 Identities = 20/36 (55%), Positives = 21/36 (58%) Frame = +2 Query: 860 KLFCAAFGDIASYCAVCLASFHTSCIHCLESCRFDK 967 K A G+IAS L F SCIH LESCRFDK Sbjct: 248 KAASVALGEIASSGGSFLGIFKASCIHSLESCRFDK 283 Score = 38.5 bits (88), Expect(2) = 9e-06 Identities = 18/41 (43%), Positives = 28/41 (68%) Frame = +1 Query: 742 VIKLHTCLTSGWWYPTHSSLNNALISIQESLKNIDWAIRKA 864 VI+L+ + T ++L+ A++SIQ++LKN DWA RKA Sbjct: 209 VIELNRSIIQAGGAATQNALSAAMVSIQDALKNSDWATRKA 249