BLASTX nr result
ID: Rehmannia28_contig00022546
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00022546 (471 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN76473.1| hypothetical protein VITISV_016007 [Vitis vinifera] 59 3e-07 >emb|CAN76473.1| hypothetical protein VITISV_016007 [Vitis vinifera] Length = 1002 Score = 58.5 bits (140), Expect = 3e-07 Identities = 26/55 (47%), Positives = 35/55 (63%) Frame = +3 Query: 306 PIVLRLDRNNYSFWKAQVLSTVRAHGFEDVLFGSSPPPASFLPSDSIGSSNLCSN 470 PI ++LDRNNY+ W++QVL + RAH + +L G P P F S S+ SS SN Sbjct: 42 PISVKLDRNNYTIWRSQVLPSARAHRLDQILIGKLPKPPRFSQSTSVNSSQPTSN 96