BLASTX nr result
ID: Rehmannia28_contig00022537
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00022537 (369 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011079862.1| PREDICTED: fatty-acid-binding protein 1 [Ses... 59 6e-08 ref|XP_012837237.1| PREDICTED: fatty-acid-binding protein 1 [Ery... 55 1e-06 gb|EYU46578.1| hypothetical protein MIMGU_mgv1a010602mg [Erythra... 55 1e-06 gb|EPS71457.1| hypothetical protein M569_03305 [Genlisea aurea] 53 9e-06 >ref|XP_011079862.1| PREDICTED: fatty-acid-binding protein 1 [Sesamum indicum] Length = 289 Score = 58.9 bits (141), Expect = 6e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 368 SILDLYIGNEPFDRKAKEDVELNLAALLGK 279 SILDLYIG+EPFDRKAKEDVELNLA+LLGK Sbjct: 260 SILDLYIGDEPFDRKAKEDVELNLASLLGK 289 >ref|XP_012837237.1| PREDICTED: fatty-acid-binding protein 1 [Erythranthe guttata] Length = 281 Score = 55.5 bits (132), Expect = 1e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 368 SILDLYIGNEPFDRKAKEDVELNLAALLGK 279 SILDLYIGNE FD KAKEDVELNLA+LLGK Sbjct: 252 SILDLYIGNESFDSKAKEDVELNLASLLGK 281 >gb|EYU46578.1| hypothetical protein MIMGU_mgv1a010602mg [Erythranthe guttata] Length = 307 Score = 55.5 bits (132), Expect = 1e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 368 SILDLYIGNEPFDRKAKEDVELNLAALLGK 279 SILDLYIGNE FD KAKEDVELNLA+LLGK Sbjct: 278 SILDLYIGNESFDSKAKEDVELNLASLLGK 307 >gb|EPS71457.1| hypothetical protein M569_03305 [Genlisea aurea] Length = 272 Score = 52.8 bits (125), Expect = 9e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -2 Query: 368 SILDLYIGNEPFDRKAKEDVELNLAALLG 282 SILDLYIGNEPFDRKAKEDV+ NLA+L G Sbjct: 243 SILDLYIGNEPFDRKAKEDVQNNLASLRG 271