BLASTX nr result
ID: Rehmannia28_contig00021353
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00021353 (508 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011079758.1| PREDICTED: rho GTPase-activating protein 2 [... 62 3e-08 >ref|XP_011079758.1| PREDICTED: rho GTPase-activating protein 2 [Sesamum indicum] Length = 466 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/55 (58%), Positives = 41/55 (74%), Gaps = 6/55 (10%) Frame = +2 Query: 2 GFRKQLERILCRDNASPRNGS------NGSFSDSRMGSSCISTSDDEESRLSSIA 148 GFRKQLE ILCR++ SP +GS S SDSR+GSSC++TSD E+SR++S A Sbjct: 382 GFRKQLEGILCREHVSPGSGSPLNADSGLSLSDSRIGSSCLTTSDGEDSRITSTA 436