BLASTX nr result
ID: Rehmannia28_contig00020837
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00020837 (393 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011069932.1| PREDICTED: homogentisate phytyltransferase 1... 55 2e-06 ref|XP_012857282.1| PREDICTED: homogentisate phytyltransferase 1... 54 7e-06 >ref|XP_011069932.1| PREDICTED: homogentisate phytyltransferase 1, chloroplastic isoform X1 [Sesamum indicum] Length = 408 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/41 (68%), Positives = 29/41 (70%) Frame = +3 Query: 270 MESLLIGSFQKPSSRLSFPFTAELCSFPSGSHVAADVVKCK 392 MESLLIGSFQKPS LS P TAELCS P G V+KCK Sbjct: 1 MESLLIGSFQKPSLLLSSPITAELCSPPIGVRAGGQVLKCK 41 >ref|XP_012857282.1| PREDICTED: homogentisate phytyltransferase 1, chloroplastic [Erythranthe guttata] gi|604301178|gb|EYU20898.1| hypothetical protein MIMGU_mgv1a007663mg [Erythranthe guttata] Length = 399 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = +3 Query: 270 MESLLIGSFQKPSSRLSFPFTAELCSFPSGSHVAADVVKCK 392 MESLLIGSFQK SS LSFP TA+LCS P+G V+KCK Sbjct: 1 MESLLIGSFQKSSSPLSFPLTADLCSLPTG-----HVLKCK 36