BLASTX nr result
ID: Rehmannia28_contig00020808
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00020808 (390 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24598.1| hypothetical protein MIMGU_mgv1a011725mg [Erythra... 110 3e-27 ref|XP_012852760.1| PREDICTED: cinnamoyl-CoA reductase 1 [Erythr... 110 8e-27 gb|ACD13265.1| cinnamoyl-CoA reductase [Paulownia sp. ZKC-2008] 109 2e-26 ref|XP_011082327.1| PREDICTED: cinnamoyl-CoA reductase 1-like [S... 108 3e-26 ref|XP_011073328.1| PREDICTED: cinnamoyl-CoA reductase 1-like [S... 107 9e-26 ref|XP_009631380.1| PREDICTED: cinnamoyl-CoA reductase 1-like [N... 106 2e-25 ref|XP_006356249.1| PREDICTED: cinnamoyl-CoA reductase 1 [Solanu... 105 7e-25 ref|NP_001234612.1| cinnamoyl-CoA reductase [Solanum lycopersicu... 105 7e-25 ref|XP_009594427.1| PREDICTED: cinnamoyl-CoA reductase 2-like [N... 105 1e-24 gb|ACF17647.1| putative cinnamoyl-CoA reductase [Capsicum annuum] 104 2e-24 ref|NP_001274901.1| cinnamoyl CoA reductase [Solanum tuberosum] ... 103 4e-24 ref|XP_006341347.1| PREDICTED: cinnamoyl CoA reductase isoform X... 103 4e-24 ref|XP_009758397.1| PREDICTED: cinnamoyl-CoA reductase 1-like [N... 103 4e-24 gb|ACI14382.1| cinnamoyl-CoA reductase [Vaccinium corymbosum] 103 4e-24 ref|XP_009762377.1| PREDICTED: cinnamoyl-CoA reductase 1-like [N... 103 5e-24 gb|AHX56186.1| cinnamoyl-CoA reductase 1 [Petunia x hybrida] 101 3e-23 pdb|4R1S|A Chain A, Crystal Structure Of Petunia Hydrida Cinnamo... 101 3e-23 ref|XP_012573124.1| PREDICTED: cinnamoyl-CoA reductase 2 [Cicer ... 100 4e-23 ref|XP_015067791.1| PREDICTED: cinnamoyl-CoA reductase 1 [Solanu... 100 5e-23 emb|CDO98223.1| unnamed protein product [Coffea canephora] 100 5e-23 >gb|EYU24598.1| hypothetical protein MIMGU_mgv1a011725mg [Erythranthe guttata] Length = 272 Score = 110 bits (275), Expect = 3e-27 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = +1 Query: 229 MPSVPGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA 390 MPSVPGKLVCVTGAGGFIASWLVK LLEKGYTVRGTVRNPEDPKNSHLREL+GA Sbjct: 1 MPSVPGKLVCVTGAGGFIASWLVKQLLEKGYTVRGTVRNPEDPKNSHLRELDGA 54 >ref|XP_012852760.1| PREDICTED: cinnamoyl-CoA reductase 1 [Erythranthe guttata] Length = 332 Score = 110 bits (275), Expect = 8e-27 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = +1 Query: 229 MPSVPGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA 390 MPSVPGKLVCVTGAGGFIASWLVK LLEKGYTVRGTVRNPEDPKNSHLREL+GA Sbjct: 1 MPSVPGKLVCVTGAGGFIASWLVKQLLEKGYTVRGTVRNPEDPKNSHLRELDGA 54 >gb|ACD13265.1| cinnamoyl-CoA reductase [Paulownia sp. ZKC-2008] Length = 332 Score = 109 bits (273), Expect = 2e-26 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = +1 Query: 229 MPSVPGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA 390 MPSV GKLVCVTGAGGFIASWLVK+LLEKGYTVRGTVRNPEDPKNSHLRELEGA Sbjct: 1 MPSVAGKLVCVTGAGGFIASWLVKVLLEKGYTVRGTVRNPEDPKNSHLRELEGA 54 >ref|XP_011082327.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Sesamum indicum] Length = 332 Score = 108 bits (271), Expect = 3e-26 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = +1 Query: 229 MPSVPGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA 390 M S+PGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA Sbjct: 1 MLSLPGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA 54 >ref|XP_011073328.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Sesamum indicum] Length = 332 Score = 107 bits (268), Expect = 9e-26 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = +1 Query: 229 MPSVPGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA 390 M SVPGKLVCVTGAGGF+ASWLVKLLLEKGY+VRGTVRNP+DPKNSHLRELEGA Sbjct: 1 MASVPGKLVCVTGAGGFVASWLVKLLLEKGYSVRGTVRNPDDPKNSHLRELEGA 54 >ref|XP_009631380.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Nicotiana tomentosiformis] gi|674810528|gb|AIL30516.1| cinnamoyl-CoA reductase [Nicotiana tabacum] Length = 332 Score = 106 bits (265), Expect = 2e-25 Identities = 49/54 (90%), Positives = 53/54 (98%) Frame = +1 Query: 229 MPSVPGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA 390 MPSV G++VCVTGAGGFIASWLVK+LLEKGYTVRGTVRNP+DPKNSHLRELEGA Sbjct: 1 MPSVSGQIVCVTGAGGFIASWLVKILLEKGYTVRGTVRNPDDPKNSHLRELEGA 54 >ref|XP_006356249.1| PREDICTED: cinnamoyl-CoA reductase 1 [Solanum tuberosum] Length = 332 Score = 105 bits (262), Expect = 7e-25 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = +1 Query: 229 MPSVPGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA 390 MPSV G++VCVTGAGGFIASWLVKLLLEKGYTVRGTVRNP+DPKN HLRELEGA Sbjct: 1 MPSVSGRVVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPDDPKNCHLRELEGA 54 >ref|NP_001234612.1| cinnamoyl-CoA reductase [Solanum lycopersicum] gi|970037628|ref|XP_015080159.1| PREDICTED: cinnamoyl-CoA reductase 1 [Solanum pennellii] gi|65306612|gb|AAY41879.1| cinnamoyl-CoA reductase [Solanum lycopersicum] Length = 332 Score = 105 bits (262), Expect = 7e-25 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = +1 Query: 229 MPSVPGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA 390 MPSV G++VCVTGAGGFIASWLVKLLLEKGYTVRGTVRNP+DPKN HLRELEGA Sbjct: 1 MPSVSGRVVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPDDPKNCHLRELEGA 54 >ref|XP_009594427.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Nicotiana tomentosiformis] Length = 337 Score = 105 bits (261), Expect = 1e-24 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = +1 Query: 229 MPSVPGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA 390 MPS GK+VCVTGAGGFIASWLVKLLLEKGYTVRGTVRNP+DPKN+HLRELEGA Sbjct: 1 MPSESGKVVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPDDPKNNHLRELEGA 54 >gb|ACF17647.1| putative cinnamoyl-CoA reductase [Capsicum annuum] Length = 334 Score = 104 bits (259), Expect = 2e-24 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = +1 Query: 229 MPSVPGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA 390 MPS GK+VCVTGAGGFIASWLVK+LL+KGYTVRGTVRNP+DPKNSHLRELEGA Sbjct: 1 MPSESGKVVCVTGAGGFIASWLVKILLQKGYTVRGTVRNPDDPKNSHLRELEGA 54 >ref|NP_001274901.1| cinnamoyl CoA reductase [Solanum tuberosum] gi|25140434|gb|AAN71761.1| cinnamoyl CoA reductase [Solanum tuberosum] Length = 332 Score = 103 bits (257), Expect = 4e-24 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = +1 Query: 229 MPSVPGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA 390 MPS GK+VCVTGAGGFIASWLVKLLLEKGYTVRGTVRNP+DPKN HL+ELEGA Sbjct: 1 MPSESGKVVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPDDPKNGHLKELEGA 54 >ref|XP_006341347.1| PREDICTED: cinnamoyl CoA reductase isoform X1 [Solanum tuberosum] Length = 332 Score = 103 bits (257), Expect = 4e-24 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = +1 Query: 229 MPSVPGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA 390 MPS GK+VCVTGAGGFIASWLVKLLLEKGYTVRGTVRNP+DPKN HL+ELEGA Sbjct: 1 MPSESGKVVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPDDPKNGHLKELEGA 54 >ref|XP_009758397.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Nicotiana sylvestris] Length = 322 Score = 103 bits (256), Expect = 4e-24 Identities = 49/54 (90%), Positives = 51/54 (94%) Frame = +1 Query: 229 MPSVPGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA 390 MPS GK+VCVTGAGGFIASWLVKLLLEKGYTVRGTVRNP+D KNSHLRELEGA Sbjct: 1 MPSESGKVVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPDDAKNSHLRELEGA 54 >gb|ACI14382.1| cinnamoyl-CoA reductase [Vaccinium corymbosum] Length = 347 Score = 103 bits (257), Expect = 4e-24 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = +1 Query: 229 MPSVPGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA 390 MPSV G+ VCVTGAGGFIASW+VKLLLEKGYTVRGTVRNP+DPKNSHLR LEGA Sbjct: 1 MPSVSGQTVCVTGAGGFIASWMVKLLLEKGYTVRGTVRNPDDPKNSHLRNLEGA 54 >ref|XP_009762377.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Nicotiana sylvestris] Length = 338 Score = 103 bits (256), Expect = 5e-24 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = +1 Query: 229 MPSVPGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA 390 MPSV G++VCVTGAGGFIASWLVK+LLEKGYTVRGTVRNP+D KNSHLRELEGA Sbjct: 1 MPSVSGQIVCVTGAGGFIASWLVKILLEKGYTVRGTVRNPDDRKNSHLRELEGA 54 >gb|AHX56186.1| cinnamoyl-CoA reductase 1 [Petunia x hybrida] Length = 333 Score = 101 bits (251), Expect = 3e-23 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = +1 Query: 229 MPSVPGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA 390 M SV G++VCVTGAGGFIASWLVK+LLEKGYTVRGTVRNP+DPKN HLRELEGA Sbjct: 1 MRSVSGQVVCVTGAGGFIASWLVKILLEKGYTVRGTVRNPDDPKNGHLRELEGA 54 >pdb|4R1S|A Chain A, Crystal Structure Of Petunia Hydrida Cinnamoyl-coa Reductase gi|720065935|pdb|4R1S|B Chain B, Crystal Structure Of Petunia Hydrida Cinnamoyl-coa Reductase gi|720065939|pdb|4R1T|A Chain A, Crystal Structure Of Petunia Hydrida Cinnamoyl-coa Reductase Length = 337 Score = 101 bits (251), Expect = 3e-23 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = +1 Query: 229 MPSVPGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA 390 M SV G++VCVTGAGGFIASWLVK+LLEKGYTVRGTVRNP+DPKN HLRELEGA Sbjct: 5 MRSVSGQVVCVTGAGGFIASWLVKILLEKGYTVRGTVRNPDDPKNGHLRELEGA 58 >ref|XP_012573124.1| PREDICTED: cinnamoyl-CoA reductase 2 [Cicer arietinum] Length = 337 Score = 100 bits (250), Expect = 4e-23 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = +1 Query: 232 PSVPGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA 390 PS G++VCVTGAGGFIASWLVKLLLEKGYTVRGT+RNPEDPKN HL+ELEGA Sbjct: 11 PSARGQIVCVTGAGGFIASWLVKLLLEKGYTVRGTLRNPEDPKNGHLKELEGA 63 >ref|XP_015067791.1| PREDICTED: cinnamoyl-CoA reductase 1 [Solanum pennellii] Length = 332 Score = 100 bits (249), Expect = 5e-23 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = +1 Query: 229 MPSVPGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA 390 MPS GK+VCVTGAGGFIASWLVKLLLEKGYTVRGTVRNP+D KN HL+ELEGA Sbjct: 1 MPSESGKVVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPDDSKNGHLKELEGA 54 >emb|CDO98223.1| unnamed protein product [Coffea canephora] Length = 332 Score = 100 bits (249), Expect = 5e-23 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = +1 Query: 229 MPSVPGKLVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPEDPKNSHLRELEGA 390 MPSV G++VCVTGAGG+IASW+VKLLLEKGYTVRGTVRNP+D KN HLRELEGA Sbjct: 1 MPSVSGQVVCVTGAGGYIASWIVKLLLEKGYTVRGTVRNPDDAKNGHLRELEGA 54