BLASTX nr result
ID: Rehmannia28_contig00020711
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00020711 (307 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011079290.1| PREDICTED: ribosomal RNA processing protein ... 88 2e-18 ref|XP_012857394.1| PREDICTED: ribosomal RNA processing protein ... 85 3e-17 gb|EPS63397.1| hypothetical protein M569_11388 [Genlisea aurea] 67 6e-11 emb|CDP21879.1| unnamed protein product [Coffea canephora] 64 3e-10 emb|CDP02991.1| unnamed protein product [Coffea canephora] 62 2e-09 >ref|XP_011079290.1| PREDICTED: ribosomal RNA processing protein 1 homolog [Sesamum indicum] Length = 576 Score = 88.2 bits (217), Expect = 2e-18 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -3 Query: 137 MRKRPREPKPILPVLASATGPALIKHLASCNTTVRSQALRLLQSW 3 M+KRPREPKP+LP LASATGPALIKHLASCNTTVRSQ+LRLLQSW Sbjct: 1 MKKRPREPKPLLPFLASATGPALIKHLASCNTTVRSQSLRLLQSW 45 >ref|XP_012857394.1| PREDICTED: ribosomal RNA processing protein 1 homolog [Erythranthe guttata] gi|604301183|gb|EYU20903.1| hypothetical protein MIMGU_mgv1a003648mg [Erythranthe guttata] Length = 572 Score = 84.7 bits (208), Expect = 3e-17 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = -3 Query: 137 MRKRPREPKPILPVLASATGPALIKHLASCNTTVRSQALRLLQSW 3 M+KR REPKPILP LASATGP LIKHLASCNTTVRSQ+LRLLQSW Sbjct: 1 MKKRAREPKPILPALASATGPGLIKHLASCNTTVRSQSLRLLQSW 45 >gb|EPS63397.1| hypothetical protein M569_11388 [Genlisea aurea] Length = 521 Score = 67.0 bits (162), Expect = 6e-11 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 137 MRKRPREPKPILPVLASATGPALIKHLASCNTTVRSQALRLLQSW 3 M+KRPRE KP P L SA GPALIK+LASCN VRSQ+L+L+QSW Sbjct: 1 MKKRPRERKPSHPSLESAAGPALIKYLASCNPRVRSQSLQLIQSW 45 >emb|CDP21879.1| unnamed protein product [Coffea canephora] Length = 259 Score = 64.3 bits (155), Expect = 3e-10 Identities = 28/49 (57%), Positives = 41/49 (83%), Gaps = 2/49 (4%) Frame = -3 Query: 143 SSMRKRPR--EPKPILPVLASATGPALIKHLASCNTTVRSQALRLLQSW 3 S+M+K+PR +PKP L L++ GP+LIKHLASCN ++RSQ+L+L+Q+W Sbjct: 63 STMKKKPRTPKPKPFLATLSALPGPSLIKHLASCNASIRSQSLKLIQAW 111 >emb|CDP02991.1| unnamed protein product [Coffea canephora] Length = 589 Score = 62.4 bits (150), Expect = 2e-09 Identities = 27/47 (57%), Positives = 39/47 (82%), Gaps = 2/47 (4%) Frame = -3 Query: 137 MRKRPR--EPKPILPVLASATGPALIKHLASCNTTVRSQALRLLQSW 3 M+K+PR +PKP L L++ GP+LIKHLASCN ++RSQ+L+L+Q+W Sbjct: 1 MKKKPRTPKPKPFLATLSALPGPSLIKHLASCNASIRSQSLKLIQAW 47