BLASTX nr result
ID: Rehmannia28_contig00020065
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00020065 (351 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006421266.1| hypothetical protein CICLE_v10006402mg [Citr... 50 2e-06 ref|XP_006421267.1| hypothetical protein CICLE_v10006402mg [Citr... 50 3e-06 >ref|XP_006421266.1| hypothetical protein CICLE_v10006402mg [Citrus clementina] gi|557523139|gb|ESR34506.1| hypothetical protein CICLE_v10006402mg [Citrus clementina] Length = 46 Score = 50.4 bits (119), Expect = 2e-06 Identities = 24/31 (77%), Positives = 26/31 (83%), Gaps = 1/31 (3%) Frame = +3 Query: 261 AGYPTENPPTGK-KKKGLPRTKAKGDRGFLE 350 AGYPTENPP GK KKK L +TK KGDRGF+E Sbjct: 14 AGYPTENPPAGKGKKKCLSQTKKKGDRGFIE 44 >ref|XP_006421267.1| hypothetical protein CICLE_v10006402mg [Citrus clementina] gi|557523140|gb|ESR34507.1| hypothetical protein CICLE_v10006402mg [Citrus clementina] Length = 60 Score = 50.4 bits (119), Expect = 3e-06 Identities = 24/31 (77%), Positives = 26/31 (83%), Gaps = 1/31 (3%) Frame = +3 Query: 261 AGYPTENPPTGK-KKKGLPRTKAKGDRGFLE 350 AGYPTENPP GK KKK L +TK KGDRGF+E Sbjct: 14 AGYPTENPPAGKGKKKCLSQTKKKGDRGFIE 44