BLASTX nr result
ID: Rehmannia28_contig00020063
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00020063 (1504 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH88997.1| Nucleotide-binding, alpha-beta plait, partial [Cy... 40 4e-06 >gb|KVH88997.1| Nucleotide-binding, alpha-beta plait, partial [Cynara cardunculus var. scolymus] Length = 349 Score = 40.4 bits (93), Expect(3) = 4e-06 Identities = 28/84 (33%), Positives = 39/84 (46%) Frame = +3 Query: 1146 SLFSIPSVAISPVW*WWI*VHHAMLPQL**GVNVSVQNAMPTTLILWRTMSSIMPCHPFT 1325 SL S+P AIS WW + +AMP+ M+SI+PC PF Sbjct: 28 SLASLP--AISQGLSWW-----------------DLYHAMPSITYPKGVMNSILPCLPFL 68 Query: 1326 EHCCETGEQ*LAMTTQLPMDLALI 1397 CC+ GE LA+ + L + L +I Sbjct: 69 NTCCQNGEPCLAVISDLRLGLNVI 92 Score = 32.0 bits (71), Expect(3) = 4e-06 Identities = 17/35 (48%), Positives = 20/35 (57%), Gaps = 5/35 (14%) Frame = +1 Query: 1414 HLSLVHHARPLHGYFHQ-----NLHIFAGFAFVYF 1503 H L+ AR LH Y HQ L + AGFAFVY+ Sbjct: 96 HHDLLDLARLLHPYVHQLFSCLTLFVLAGFAFVYY 130 Score = 26.9 bits (58), Expect(3) = 4e-06 Identities = 14/20 (70%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = +2 Query: 1091 NLSTCQLS-YTQMELFYISF 1147 NLS C S Y+QME FYISF Sbjct: 3 NLSACLPSFYSQMESFYISF 22