BLASTX nr result
ID: Rehmannia28_contig00019967
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00019967 (907 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012853543.1| PREDICTED: transmembrane and coiled-coil dom... 67 7e-09 ref|XP_011090424.1| PREDICTED: transmembrane and coiled-coil dom... 66 1e-08 ref|XP_012845229.1| PREDICTED: transmembrane and coiled-coil dom... 62 4e-07 gb|KDP39981.1| hypothetical protein JCGZ_03512 [Jatropha curcas] 54 8e-06 >ref|XP_012853543.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 4-like [Erythranthe guttata] gi|604304829|gb|EYU24080.1| hypothetical protein MIMGU_mgv1a002505mg [Erythranthe guttata] Length = 665 Score = 67.0 bits (162), Expect = 7e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 2 GHSSYLWGTQQILEQLELDTYYPVYNRKVVKS 97 GHSSYLWGTQ ILEQLELDTYYPV+NRK+VKS Sbjct: 634 GHSSYLWGTQHILEQLELDTYYPVFNRKIVKS 665 >ref|XP_011090424.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 4-like [Sesamum indicum] gi|747085899|ref|XP_011090425.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 4-like [Sesamum indicum] Length = 672 Score = 66.2 bits (160), Expect = 1e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 2 GHSSYLWGTQQILEQLELDTYYPVYNRKVVKS 97 GHSSYLW TQQILEQLELDTYYPV+NRKVVKS Sbjct: 641 GHSSYLWRTQQILEQLELDTYYPVFNRKVVKS 672 >ref|XP_012845229.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 4-like [Erythranthe guttata] gi|604319982|gb|EYU31146.1| hypothetical protein MIMGU_mgv1a002490mg [Erythranthe guttata] Length = 667 Score = 61.6 bits (148), Expect = 4e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 2 GHSSYLWGTQQILEQLELDTYYPVYNRKVVKS 97 GHSSYLW TQQILEQLELDTYYPV+N+ V+KS Sbjct: 636 GHSSYLWKTQQILEQLELDTYYPVFNQSVLKS 667 >gb|KDP39981.1| hypothetical protein JCGZ_03512 [Jatropha curcas] Length = 100 Score = 53.5 bits (127), Expect = 8e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = +2 Query: 2 GHSSYLWGTQQILEQLELDTYYPVYNRKV 88 GHSSYLW TQQILEQLELD YYPV+ V Sbjct: 68 GHSSYLWATQQILEQLELDAYYPVFRNTV 96