BLASTX nr result
ID: Rehmannia28_contig00019906
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00019906 (457 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098712.1| PREDICTED: membrane-anchored ubiquitin-fold ... 62 1e-09 emb|CDP02302.1| unnamed protein product [Coffea canephora] 61 3e-09 ref|XP_006431228.1| hypothetical protein CICLE_v10013136mg [Citr... 59 1e-08 ref|XP_007032679.1| Membrane-anchored ubiquitin-fold protein 1 p... 59 2e-08 ref|XP_008341639.1| PREDICTED: membrane-anchored ubiquitin-fold ... 58 3e-08 ref|XP_007217187.1| hypothetical protein PRUPE_ppa013551mg [Prun... 58 3e-08 gb|KHG04368.1| Membrane-anchored ubiquitin-fold 2 -like protein ... 57 6e-08 ref|XP_012460358.1| PREDICTED: membrane-anchored ubiquitin-fold ... 57 8e-08 ref|XP_008379398.1| PREDICTED: membrane-anchored ubiquitin-fold ... 57 8e-08 ref|XP_010661123.1| PREDICTED: membrane-anchored ubiquitin-fold ... 57 8e-08 ref|XP_009365845.1| PREDICTED: membrane-anchored ubiquitin-fold ... 56 2e-07 ref|XP_004491880.1| PREDICTED: membrane-anchored ubiquitin-fold ... 56 2e-07 ref|XP_009360557.1| PREDICTED: membrane-anchored ubiquitin-fold ... 55 3e-07 ref|XP_012840602.1| PREDICTED: membrane-anchored ubiquitin-fold ... 55 3e-07 gb|KYP64722.1| Membrane-anchored ubiquitin-fold protein 1 [Cajan... 55 6e-07 ref|XP_015879895.1| PREDICTED: membrane-anchored ubiquitin-fold ... 54 8e-07 ref|XP_010550022.1| PREDICTED: membrane-anchored ubiquitin-fold ... 54 8e-07 ref|XP_006431229.1| hypothetical protein CICLE_v10013136mg [Citr... 54 9e-07 ref|XP_012483518.1| PREDICTED: membrane-anchored ubiquitin-fold ... 54 1e-06 ref|XP_002526078.2| PREDICTED: membrane-anchored ubiquitin-fold ... 54 1e-06 >ref|XP_011098712.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1 [Sesamum indicum] gi|747101189|ref|XP_011098713.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1 [Sesamum indicum] gi|747101191|ref|XP_011098714.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1 [Sesamum indicum] Length = 117 Score = 62.0 bits (149), Expect = 1e-09 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +2 Query: 2 PGVVTTMHVVVQQPPTEKEKKLPSNPKQNSCGCVIL 109 PG VTTMHVVVQ P TEKE+KLP++PKQN C CVIL Sbjct: 82 PGGVTTMHVVVQPPSTEKERKLPTDPKQNKCVCVIL 117 >emb|CDP02302.1| unnamed protein product [Coffea canephora] Length = 125 Score = 60.8 bits (146), Expect = 3e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +2 Query: 2 PGVVTTMHVVVQQPPTEKEKKLPSNPKQNSCGCVIL 109 PG VTTMHVVVQ PP EKEK +PS+PKQN CGCVIL Sbjct: 91 PGGVTTMHVVVQPPPQEKEK-VPSDPKQNKCGCVIL 125 >ref|XP_006431228.1| hypothetical protein CICLE_v10013136mg [Citrus clementina] gi|567877281|ref|XP_006431230.1| hypothetical protein CICLE_v10013136mg [Citrus clementina] gi|568858293|ref|XP_006482688.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1 isoform X2 [Citrus sinensis] gi|557533285|gb|ESR44468.1| hypothetical protein CICLE_v10013136mg [Citrus clementina] gi|557533287|gb|ESR44470.1| hypothetical protein CICLE_v10013136mg [Citrus clementina] gi|641853851|gb|KDO72669.1| hypothetical protein CISIN_1g033465mg [Citrus sinensis] gi|641853852|gb|KDO72670.1| hypothetical protein CISIN_1g033465mg [Citrus sinensis] Length = 117 Score = 58.9 bits (141), Expect = 1e-08 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = +2 Query: 2 PGVVTTMHVVVQQPPTEKEKKLPSNPKQNSCGCVIL 109 PG VTTMHVVVQ P TEKEKK S PKQN C CVIL Sbjct: 82 PGGVTTMHVVVQPPSTEKEKKAASQPKQNKCVCVIL 117 >ref|XP_007032679.1| Membrane-anchored ubiquitin-fold protein 1 precursor isoform 1 [Theobroma cacao] gi|508711708|gb|EOY03605.1| Membrane-anchored ubiquitin-fold protein 1 precursor isoform 1 [Theobroma cacao] Length = 117 Score = 58.5 bits (140), Expect = 2e-08 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = +2 Query: 2 PGVVTTMHVVVQQPPTEKEKKLPSNPKQNSCGCVIL 109 PG VTTMHVVVQ PP EKEKK + PKQN C CVIL Sbjct: 82 PGGVTTMHVVVQPPPLEKEKKATNQPKQNKCVCVIL 117 >ref|XP_008341639.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1 [Malus domestica] gi|658012726|ref|XP_008341640.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1 [Malus domestica] Length = 117 Score = 58.2 bits (139), Expect = 3e-08 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = +2 Query: 2 PGVVTTMHVVVQQPPTEKEKKLPSNPKQNSCGCVIL 109 PG VTTMHVVVQ P EKEKKL S PKQN C CVIL Sbjct: 82 PGGVTTMHVVVQPPSQEKEKKLMSEPKQNKCVCVIL 117 >ref|XP_007217187.1| hypothetical protein PRUPE_ppa013551mg [Prunus persica] gi|645249668|ref|XP_008230848.1| PREDICTED: membrane-anchored ubiquitin-fold protein 2 [Prunus mume] gi|645249672|ref|XP_008230849.1| PREDICTED: membrane-anchored ubiquitin-fold protein 2 [Prunus mume] gi|645249674|ref|XP_008230850.1| PREDICTED: membrane-anchored ubiquitin-fold protein 2 [Prunus mume] gi|462413337|gb|EMJ18386.1| hypothetical protein PRUPE_ppa013551mg [Prunus persica] Length = 117 Score = 58.2 bits (139), Expect = 3e-08 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = +2 Query: 2 PGVVTTMHVVVQQPPTEKEKKLPSNPKQNSCGCVIL 109 PG VTTMHVVVQ P EKEKKL S PKQN C CVIL Sbjct: 82 PGGVTTMHVVVQPPSLEKEKKLMSEPKQNKCVCVIL 117 >gb|KHG04368.1| Membrane-anchored ubiquitin-fold 2 -like protein [Gossypium arboreum] Length = 117 Score = 57.4 bits (137), Expect = 6e-08 Identities = 27/36 (75%), Positives = 27/36 (75%) Frame = +2 Query: 2 PGVVTTMHVVVQQPPTEKEKKLPSNPKQNSCGCVIL 109 PG VTTMHVVVQ PP EKEKK PKQN C CVIL Sbjct: 82 PGGVTTMHVVVQPPPVEKEKKAVIEPKQNKCVCVIL 117 >ref|XP_012460358.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1-like [Gossypium raimondii] gi|763808746|gb|KJB75648.1| hypothetical protein B456_012G050000 [Gossypium raimondii] gi|763808747|gb|KJB75649.1| hypothetical protein B456_012G050000 [Gossypium raimondii] gi|763808748|gb|KJB75650.1| hypothetical protein B456_012G050000 [Gossypium raimondii] gi|763808750|gb|KJB75652.1| hypothetical protein B456_012G050000 [Gossypium raimondii] gi|763808751|gb|KJB75653.1| hypothetical protein B456_012G050000 [Gossypium raimondii] Length = 117 Score = 57.0 bits (136), Expect = 8e-08 Identities = 27/36 (75%), Positives = 27/36 (75%) Frame = +2 Query: 2 PGVVTTMHVVVQQPPTEKEKKLPSNPKQNSCGCVIL 109 PG VTTMHVVVQ PP EKEKK PKQN C CVIL Sbjct: 82 PGGVTTMHVVVQPPPVEKEKKAIIEPKQNKCVCVIL 117 >ref|XP_008379398.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1-like [Malus domestica] gi|657975114|ref|XP_008379399.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1-like [Malus domestica] Length = 117 Score = 57.0 bits (136), Expect = 8e-08 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = +2 Query: 2 PGVVTTMHVVVQQPPTEKEKKLPSNPKQNSCGCVIL 109 PG VTTMHVVVQ P EKEKKL + PKQN C CVIL Sbjct: 82 PGGVTTMHVVVQPPSQEKEKKLMNEPKQNKCVCVIL 117 >ref|XP_010661123.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1 [Vitis vinifera] gi|296082984|emb|CBI22285.3| unnamed protein product [Vitis vinifera] Length = 117 Score = 57.0 bits (136), Expect = 8e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +2 Query: 2 PGVVTTMHVVVQQPPTEKEKKLPSNPKQNSCGCVIL 109 PG VTTMHVVVQ P ++KEKK+ S PKQN C CVIL Sbjct: 82 PGGVTTMHVVVQPPSSDKEKKVASQPKQNKCVCVIL 117 >ref|XP_009365845.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1-like [Pyrus x bretschneideri] gi|694379298|ref|XP_009365846.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1-like [Pyrus x bretschneideri] Length = 117 Score = 56.2 bits (134), Expect = 2e-07 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +2 Query: 2 PGVVTTMHVVVQQPPTEKEKKLPSNPKQNSCGCVIL 109 PG VTTMHV+VQ P EKEKKL + PKQN C CVIL Sbjct: 82 PGGVTTMHVIVQPPSQEKEKKLMNEPKQNKCICVIL 117 >ref|XP_004491880.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1-like [Cicer arietinum] Length = 117 Score = 55.8 bits (133), Expect = 2e-07 Identities = 26/36 (72%), Positives = 26/36 (72%) Frame = +2 Query: 2 PGVVTTMHVVVQQPPTEKEKKLPSNPKQNSCGCVIL 109 PG VTTMHVVVQ P TEKEKK KQ CGCVIL Sbjct: 82 PGTVTTMHVVVQPPTTEKEKKTAKEAKQPKCGCVIL 117 >ref|XP_009360557.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1-like [Pyrus x bretschneideri] gi|694361907|ref|XP_009360558.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1-like [Pyrus x bretschneideri] Length = 117 Score = 55.5 bits (132), Expect = 3e-07 Identities = 27/36 (75%), Positives = 27/36 (75%) Frame = +2 Query: 2 PGVVTTMHVVVQQPPTEKEKKLPSNPKQNSCGCVIL 109 PG VTTMHVVVQ P EKEKK S PKQN C CVIL Sbjct: 82 PGGVTTMHVVVQPPSQEKEKKPMSEPKQNKCVCVIL 117 >ref|XP_012840602.1| PREDICTED: membrane-anchored ubiquitin-fold protein 2-like [Erythranthe guttata] gi|604329293|gb|EYU34624.1| hypothetical protein MIMGU_mgv1a016505mg [Erythranthe guttata] Length = 119 Score = 55.5 bits (132), Expect = 3e-07 Identities = 26/38 (68%), Positives = 30/38 (78%), Gaps = 2/38 (5%) Frame = +2 Query: 2 PGVVTTMHVVVQQPPTEKEKKL--PSNPKQNSCGCVIL 109 PG VTTMHV+VQ PPT+KE+K +PKQN CGCVIL Sbjct: 82 PGGVTTMHVLVQPPPTQKERKKVHSDDPKQNKCGCVIL 119 >gb|KYP64722.1| Membrane-anchored ubiquitin-fold protein 1 [Cajanus cajan] Length = 117 Score = 54.7 bits (130), Expect = 6e-07 Identities = 26/36 (72%), Positives = 26/36 (72%) Frame = +2 Query: 2 PGVVTTMHVVVQQPPTEKEKKLPSNPKQNSCGCVIL 109 PG VTTMHVVVQ P TEKEKK S QN C CVIL Sbjct: 82 PGTVTTMHVVVQHPVTEKEKKAASKATQNKCMCVIL 117 >ref|XP_015879895.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1 [Ziziphus jujuba] Length = 117 Score = 54.3 bits (129), Expect = 8e-07 Identities = 26/36 (72%), Positives = 26/36 (72%) Frame = +2 Query: 2 PGVVTTMHVVVQQPPTEKEKKLPSNPKQNSCGCVIL 109 PG VTTMHVVVQ P EKEKK S PK N C CVIL Sbjct: 82 PGGVTTMHVVVQTPLVEKEKKASSQPKDNKCVCVIL 117 >ref|XP_010550022.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1 [Tarenaya hassleriana] Length = 117 Score = 54.3 bits (129), Expect = 8e-07 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = +2 Query: 2 PGVVTTMHVVVQQPPTEKEKKLPSNPKQNSCGCVIL 109 PG VTTMHV++Q PP+EKEKK S+ KQN C C I+ Sbjct: 82 PGSVTTMHVIIQPPPSEKEKKTKSDSKQNKCVCSIM 117 >ref|XP_006431229.1| hypothetical protein CICLE_v10013136mg [Citrus clementina] gi|568858289|ref|XP_006482686.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1 isoform X1 [Citrus sinensis] gi|568858291|ref|XP_006482687.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1 isoform X1 [Citrus sinensis] gi|557533286|gb|ESR44469.1| hypothetical protein CICLE_v10013136mg [Citrus clementina] gi|641853850|gb|KDO72668.1| hypothetical protein CISIN_1g033465mg [Citrus sinensis] Length = 118 Score = 54.3 bits (129), Expect = 9e-07 Identities = 28/37 (75%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Frame = +2 Query: 2 PGVVTTMHVVVQQPPTEK-EKKLPSNPKQNSCGCVIL 109 PG VTTMHVVVQ P TEK EKK S PKQN C CVIL Sbjct: 82 PGGVTTMHVVVQPPSTEKAEKKAASQPKQNKCVCVIL 118 >ref|XP_012483518.1| PREDICTED: membrane-anchored ubiquitin-fold protein 2-like [Gossypium raimondii] gi|823167143|ref|XP_012483519.1| PREDICTED: membrane-anchored ubiquitin-fold protein 2-like [Gossypium raimondii] gi|823167145|ref|XP_012483520.1| PREDICTED: membrane-anchored ubiquitin-fold protein 2-like [Gossypium raimondii] gi|823167147|ref|XP_012483521.1| PREDICTED: membrane-anchored ubiquitin-fold protein 2-like [Gossypium raimondii] gi|823167149|ref|XP_012483522.1| PREDICTED: membrane-anchored ubiquitin-fold protein 2-like [Gossypium raimondii] gi|823167151|ref|XP_012483523.1| PREDICTED: membrane-anchored ubiquitin-fold protein 2-like [Gossypium raimondii] gi|763766242|gb|KJB33457.1| hypothetical protein B456_006G011700 [Gossypium raimondii] gi|763766243|gb|KJB33458.1| hypothetical protein B456_006G011700 [Gossypium raimondii] gi|763766244|gb|KJB33459.1| hypothetical protein B456_006G011700 [Gossypium raimondii] Length = 116 Score = 53.9 bits (128), Expect = 1e-06 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = +2 Query: 2 PGVVTTMHVVVQQPPTEKEKKLPSNPKQNSCGCVIL 109 PG VTTMHV+VQ PP EKEKK S PKQN C CVIL Sbjct: 82 PGGVTTMHVIVQ-PPLEKEKKAISQPKQNKCLCVIL 116 >ref|XP_002526078.2| PREDICTED: membrane-anchored ubiquitin-fold protein 2 [Ricinus communis] Length = 117 Score = 53.9 bits (128), Expect = 1e-06 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +2 Query: 2 PGVVTTMHVVVQQPPTEKEKKLPSNPKQNSCGCVIL 109 PG VTTMHVVVQ +EKEKK S PKQN C CVIL Sbjct: 82 PGGVTTMHVVVQPSSSEKEKKSSSQPKQNKCVCVIL 117