BLASTX nr result
ID: Rehmannia28_contig00019904
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00019904 (520 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012836635.1| PREDICTED: histidine-containing phosphotrans... 97 1e-22 ref|XP_012836634.1| PREDICTED: histidine-containing phosphotrans... 97 1e-22 ref|XP_009786497.1| PREDICTED: histidine-containing phosphotrans... 94 3e-21 ref|XP_009631142.1| PREDICTED: histidine-containing phosphotrans... 93 4e-21 ref|XP_010242575.1| PREDICTED: histidine-containing phosphotrans... 92 1e-20 ref|XP_009762355.1| PREDICTED: histidine-containing phosphotrans... 90 8e-20 gb|ALC76737.1| histidine-containing phosphotransfer 1a [Malus do... 90 8e-20 ref|XP_015888335.1| PREDICTED: histidine-containing phosphotrans... 89 2e-19 ref|XP_009352177.1| PREDICTED: histidine-containing phosphotrans... 89 2e-19 ref|XP_010279276.1| PREDICTED: histidine-containing phosphotrans... 89 2e-19 ref|XP_007035416.1| Histidine-containing phosphotransfer protein... 89 2e-19 ref|XP_015888334.1| PREDICTED: histidine-containing phosphotrans... 89 4e-19 ref|XP_008360310.1| PREDICTED: histidine-containing phosphotrans... 88 5e-19 ref|XP_008340876.1| PREDICTED: histidine-containing phosphotrans... 87 7e-19 gb|KYP72778.1| Histidine-containing phosphotransfer protein 1 [C... 87 7e-19 ref|XP_009607172.1| PREDICTED: histidine-containing phosphotrans... 87 9e-19 ref|XP_006352793.1| PREDICTED: histidine-containing phosphotrans... 86 2e-18 ref|XP_008223072.1| PREDICTED: histidine-containing phosphotrans... 86 3e-18 emb|CDP17989.1| unnamed protein product [Coffea canephora] 86 3e-18 gb|AAK38843.1|AF346308_1 histidine-containing phosphotransfer pr... 86 3e-18 >ref|XP_012836635.1| PREDICTED: histidine-containing phosphotransfer protein 1-like isoform X2 [Erythranthe guttata] Length = 146 Score = 97.1 bits (240), Expect = 1e-22 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = +2 Query: 2 RNFCEEKNLDGCLRCLQQVKHEYYLVKNKLETLFRLERQILEAGGTVPMIS 154 RNFCEEKNLDGCLRCLQQ+ HEY LVKNKLE +FRLERQILEAGGT+P+I+ Sbjct: 96 RNFCEEKNLDGCLRCLQQINHEYCLVKNKLENVFRLERQILEAGGTIPLIA 146 >ref|XP_012836634.1| PREDICTED: histidine-containing phosphotransfer protein 1-like isoform X1 [Erythranthe guttata] gi|604333812|gb|EYU38122.1| hypothetical protein MIMGU_mgv1a015593mg [Erythranthe guttata] Length = 152 Score = 97.1 bits (240), Expect = 1e-22 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = +2 Query: 2 RNFCEEKNLDGCLRCLQQVKHEYYLVKNKLETLFRLERQILEAGGTVPMIS 154 RNFCEEKNLDGCLRCLQQ+ HEY LVKNKLE +FRLERQILEAGGT+P+I+ Sbjct: 102 RNFCEEKNLDGCLRCLQQINHEYCLVKNKLENVFRLERQILEAGGTIPLIA 152 >ref|XP_009786497.1| PREDICTED: histidine-containing phosphotransfer protein 1-like [Nicotiana sylvestris] Length = 152 Score = 93.6 bits (231), Expect = 3e-21 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = +2 Query: 2 RNFCEEKNLDGCLRCLQQVKHEYYLVKNKLETLFRLERQILEAGGTVPMIS 154 RNFCEEKNL+GC++CLQ KHEY+LVKNKLETLFRLE+QIL AGGTVP++S Sbjct: 102 RNFCEEKNLEGCMQCLQHAKHEYFLVKNKLETLFRLEQQILAAGGTVPVLS 152 >ref|XP_009631142.1| PREDICTED: histidine-containing phosphotransfer protein 1-like [Nicotiana tomentosiformis] Length = 152 Score = 93.2 bits (230), Expect = 4e-21 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = +2 Query: 2 RNFCEEKNLDGCLRCLQQVKHEYYLVKNKLETLFRLERQILEAGGTVPMIS 154 RNFCEEKNL+GC++CLQ KHEY+LVKNKLETLFRLE+QIL AGGTVP++S Sbjct: 102 RNFCEEKNLEGCVQCLQHAKHEYFLVKNKLETLFRLEQQILAAGGTVPVLS 152 >ref|XP_010242575.1| PREDICTED: histidine-containing phosphotransfer protein 1 isoform X1 [Nelumbo nucifera] Length = 150 Score = 92.0 bits (227), Expect = 1e-20 Identities = 40/49 (81%), Positives = 47/49 (95%) Frame = +2 Query: 2 RNFCEEKNLDGCLRCLQQVKHEYYLVKNKLETLFRLERQILEAGGTVPM 148 RNFCEE+N++GCLRCLQQVKHEY LVKNKLETLFRLE+Q+L AGG++PM Sbjct: 101 RNFCEEQNIEGCLRCLQQVKHEYALVKNKLETLFRLEQQVLAAGGSIPM 149 >ref|XP_009762355.1| PREDICTED: histidine-containing phosphotransfer protein 1-like [Nicotiana sylvestris] Length = 152 Score = 89.7 bits (221), Expect = 8e-20 Identities = 38/51 (74%), Positives = 48/51 (94%) Frame = +2 Query: 2 RNFCEEKNLDGCLRCLQQVKHEYYLVKNKLETLFRLERQILEAGGTVPMIS 154 RNFCE+KNL+GC++CLQ +KHEY+LVKNKLETL RLE+QIL AGGT+P++S Sbjct: 102 RNFCEQKNLEGCVQCLQHMKHEYFLVKNKLETLLRLEQQILAAGGTIPVLS 152 >gb|ALC76737.1| histidine-containing phosphotransfer 1a [Malus domestica] Length = 154 Score = 89.7 bits (221), Expect = 8e-20 Identities = 38/50 (76%), Positives = 47/50 (94%) Frame = +2 Query: 2 RNFCEEKNLDGCLRCLQQVKHEYYLVKNKLETLFRLERQILEAGGTVPMI 151 RNFCEEKN +GC+RC+QQVKHEYYLVK+KLETLF LE+QI+ AGG++PM+ Sbjct: 101 RNFCEEKNTEGCVRCVQQVKHEYYLVKSKLETLFALEQQIMAAGGSIPML 150 >ref|XP_015888335.1| PREDICTED: histidine-containing phosphotransfer protein 1 isoform X2 [Ziziphus jujuba] Length = 154 Score = 89.0 bits (219), Expect = 2e-19 Identities = 39/49 (79%), Positives = 46/49 (93%) Frame = +2 Query: 2 RNFCEEKNLDGCLRCLQQVKHEYYLVKNKLETLFRLERQILEAGGTVPM 148 RNFCEE+N++GCL CLQQVK EYYLVKNKLETLFRLE+QI+ AGG++PM Sbjct: 101 RNFCEEQNIEGCLGCLQQVKQEYYLVKNKLETLFRLEQQIVAAGGSIPM 149 >ref|XP_009352177.1| PREDICTED: histidine-containing phosphotransfer protein 1-like [Pyrus x bretschneideri] Length = 154 Score = 89.0 bits (219), Expect = 2e-19 Identities = 37/50 (74%), Positives = 47/50 (94%) Frame = +2 Query: 2 RNFCEEKNLDGCLRCLQQVKHEYYLVKNKLETLFRLERQILEAGGTVPMI 151 RNFCEEKN +GC+RC+QQVKHEYYLVK+KLETLF +E+QI+ AGG++PM+ Sbjct: 101 RNFCEEKNTEGCVRCVQQVKHEYYLVKSKLETLFAMEQQIMAAGGSIPML 150 >ref|XP_010279276.1| PREDICTED: histidine-containing phosphotransfer protein 1-like [Nelumbo nucifera] Length = 151 Score = 88.6 bits (218), Expect = 2e-19 Identities = 39/50 (78%), Positives = 47/50 (94%) Frame = +2 Query: 2 RNFCEEKNLDGCLRCLQQVKHEYYLVKNKLETLFRLERQILEAGGTVPMI 151 RNFCEE+N++GC+RCLQQVKHEY LVKNKLETLFRLE+Q+L AGG+V M+ Sbjct: 101 RNFCEEQNIEGCVRCLQQVKHEYALVKNKLETLFRLEQQVLAAGGSVTMM 150 >ref|XP_007035416.1| Histidine-containing phosphotransfer protein 1 isoform 1 [Theobroma cacao] gi|590660511|ref|XP_007035417.1| Histidine-containing phosphotransfer protein 1 isoform 1 [Theobroma cacao] gi|508714445|gb|EOY06342.1| Histidine-containing phosphotransfer protein 1 isoform 1 [Theobroma cacao] gi|508714446|gb|EOY06343.1| Histidine-containing phosphotransfer protein 1 isoform 1 [Theobroma cacao] Length = 154 Score = 88.6 bits (218), Expect = 2e-19 Identities = 38/50 (76%), Positives = 47/50 (94%) Frame = +2 Query: 2 RNFCEEKNLDGCLRCLQQVKHEYYLVKNKLETLFRLERQILEAGGTVPMI 151 RNFCEE+N++ CLRCLQQVK EYYLVKNKLETLFRLE+QI+ AGG++P++ Sbjct: 101 RNFCEEQNIEACLRCLQQVKQEYYLVKNKLETLFRLEQQIVAAGGSIPLM 150 >ref|XP_015888334.1| PREDICTED: histidine-containing phosphotransfer protein 1 isoform X1 [Ziziphus jujuba] Length = 188 Score = 89.0 bits (219), Expect = 4e-19 Identities = 39/49 (79%), Positives = 46/49 (93%) Frame = +2 Query: 2 RNFCEEKNLDGCLRCLQQVKHEYYLVKNKLETLFRLERQILEAGGTVPM 148 RNFCEE+N++GCL CLQQVK EYYLVKNKLETLFRLE+QI+ AGG++PM Sbjct: 135 RNFCEEQNIEGCLGCLQQVKQEYYLVKNKLETLFRLEQQIVAAGGSIPM 183 >ref|XP_008360310.1| PREDICTED: histidine-containing phosphotransfer protein 1-like [Malus domestica] Length = 154 Score = 87.8 bits (216), Expect = 5e-19 Identities = 37/50 (74%), Positives = 46/50 (92%) Frame = +2 Query: 2 RNFCEEKNLDGCLRCLQQVKHEYYLVKNKLETLFRLERQILEAGGTVPMI 151 RNFCEEKN +GC+RC+QQVKHEYYLVK+KLETLF E+QI+ AGG++PM+ Sbjct: 101 RNFCEEKNTEGCVRCVQQVKHEYYLVKSKLETLFXXEQQIMAAGGSIPML 150 >ref|XP_008340876.1| PREDICTED: histidine-containing phosphotransfer protein 1-like [Malus domestica] gi|694386592|ref|XP_009369074.1| PREDICTED: histidine-containing phosphotransfer protein 1-like [Pyrus x bretschneideri] gi|924899001|gb|ALC76738.1| histidine-containing phosphotransfer 1b [Malus domestica] Length = 154 Score = 87.4 bits (215), Expect = 7e-19 Identities = 36/50 (72%), Positives = 47/50 (94%) Frame = +2 Query: 2 RNFCEEKNLDGCLRCLQQVKHEYYLVKNKLETLFRLERQILEAGGTVPMI 151 RNFCEE+N +GC+RC+QQVKHEYYLVK+KLETLF +E+QI+ AGG++PM+ Sbjct: 101 RNFCEEQNTEGCVRCVQQVKHEYYLVKSKLETLFAMEQQIMAAGGSIPML 150 >gb|KYP72778.1| Histidine-containing phosphotransfer protein 1 [Cajanus cajan] Length = 157 Score = 87.4 bits (215), Expect = 7e-19 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = +2 Query: 2 RNFCEEKNLDGCLRCLQQVKHEYYLVKNKLETLFRLERQILEAGGTVPMI 151 RNFCEE+N D CLRCLQQVK EY LVKNKLETLFRLE+QI+ AGG++PM+ Sbjct: 101 RNFCEEQNTDACLRCLQQVKQEYCLVKNKLETLFRLEQQIVAAGGSIPMV 150 >ref|XP_009607172.1| PREDICTED: histidine-containing phosphotransfer protein 1-like [Nicotiana tomentosiformis] Length = 152 Score = 87.0 bits (214), Expect = 9e-19 Identities = 38/51 (74%), Positives = 47/51 (92%) Frame = +2 Query: 2 RNFCEEKNLDGCLRCLQQVKHEYYLVKNKLETLFRLERQILEAGGTVPMIS 154 RNFCE+KNL+GC++CLQ VKHEY+LVKNKLETL RLE+QIL AGGT+ ++S Sbjct: 102 RNFCEQKNLEGCVQCLQHVKHEYFLVKNKLETLLRLEQQILAAGGTILVLS 152 >ref|XP_006352793.1| PREDICTED: histidine-containing phosphotransfer protein 1-like [Solanum tuberosum] Length = 152 Score = 86.3 bits (212), Expect = 2e-18 Identities = 37/51 (72%), Positives = 46/51 (90%) Frame = +2 Query: 2 RNFCEEKNLDGCLRCLQQVKHEYYLVKNKLETLFRLERQILEAGGTVPMIS 154 + FCEEKN++GC++CLQQVKHEY+LVKNKLETL RLE+QIL AGG +P +S Sbjct: 102 KTFCEEKNIEGCVQCLQQVKHEYFLVKNKLETLMRLEKQILAAGGRIPDLS 152 >ref|XP_008223072.1| PREDICTED: histidine-containing phosphotransfer protein 1 [Prunus mume] Length = 154 Score = 85.9 bits (211), Expect = 3e-18 Identities = 36/50 (72%), Positives = 46/50 (92%) Frame = +2 Query: 2 RNFCEEKNLDGCLRCLQQVKHEYYLVKNKLETLFRLERQILEAGGTVPMI 151 RNFCEE+N DGC+RC+QQVK EYYLVKNKLETLF +E+QI+ AGG++P++ Sbjct: 101 RNFCEEQNTDGCVRCVQQVKQEYYLVKNKLETLFAMEQQIVAAGGSIPIL 150 >emb|CDP17989.1| unnamed protein product [Coffea canephora] Length = 151 Score = 85.5 bits (210), Expect = 3e-18 Identities = 36/49 (73%), Positives = 45/49 (91%) Frame = +2 Query: 2 RNFCEEKNLDGCLRCLQQVKHEYYLVKNKLETLFRLERQILEAGGTVPM 148 RN+CEE+N +GCLRCLQ VKHEY LVKNKLET+F+LE+Q+L AGG++PM Sbjct: 102 RNYCEEQNTEGCLRCLQLVKHEYSLVKNKLETMFKLEKQVLAAGGSIPM 150 >gb|AAK38843.1|AF346308_1 histidine-containing phosphotransfer protein [Catharanthus roseus] Length = 151 Score = 85.5 bits (210), Expect = 3e-18 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = +2 Query: 2 RNFCEEKNLDGCLRCLQQVKHEYYLVKNKLETLFRLERQILEAGGTVPMI 151 RNFC+E N+D CLRCLQ VK EY LVKNKLETLFRLE+QIL AGG +PM+ Sbjct: 101 RNFCDELNIDACLRCLQHVKQEYLLVKNKLETLFRLEQQILAAGGAIPMV 150