BLASTX nr result
ID: Rehmannia28_contig00019508
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00019508 (410 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099805.1| PREDICTED: uncharacterized protein LOC105178... 61 2e-08 gb|EYU43491.1| hypothetical protein MIMGU_mgv1a0105242mg, partia... 57 3e-07 ref|XP_012829968.1| PREDICTED: uncharacterized protein LOC105951... 57 4e-07 ref|XP_012829967.1| PREDICTED: uncharacterized protein LOC105951... 57 5e-07 ref|XP_012829955.1| PREDICTED: uncharacterized protein LOC105951... 55 3e-06 >ref|XP_011099805.1| PREDICTED: uncharacterized protein LOC105178130 [Sesamum indicum] Length = 262 Score = 60.8 bits (146), Expect = 2e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 408 KHQGSSKADAEEKFKHCVDAYKSLCNTFSTA 316 KHQGSS+ADAEEKFKHCV+AYKSLC+ FST+ Sbjct: 232 KHQGSSRADAEEKFKHCVNAYKSLCDAFSTS 262 >gb|EYU43491.1| hypothetical protein MIMGU_mgv1a0105242mg, partial [Erythranthe guttata] Length = 251 Score = 57.0 bits (136), Expect = 3e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 408 KHQGSSKADAEEKFKHCVDAYKSLCNTFSTA 316 KHQGSSK DAEEKFK CV+AYKSLCNT S A Sbjct: 220 KHQGSSKGDAEEKFKDCVNAYKSLCNTLSGA 250 >ref|XP_012829968.1| PREDICTED: uncharacterized protein LOC105951122 isoform X2 [Erythranthe guttata] Length = 300 Score = 57.0 bits (136), Expect = 4e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 408 KHQGSSKADAEEKFKHCVDAYKSLCNTFSTA 316 KHQGSSK DAEEKFK CV+AYKSLCNT S A Sbjct: 269 KHQGSSKGDAEEKFKDCVNAYKSLCNTLSGA 299 >ref|XP_012829967.1| PREDICTED: uncharacterized protein LOC105951122 isoform X1 [Erythranthe guttata] Length = 310 Score = 57.0 bits (136), Expect = 5e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 408 KHQGSSKADAEEKFKHCVDAYKSLCNTFSTA 316 KHQGSSK DAEEKFK CV+AYKSLCNT S A Sbjct: 279 KHQGSSKGDAEEKFKDCVNAYKSLCNTLSGA 309 >ref|XP_012829955.1| PREDICTED: uncharacterized protein LOC105951109 [Erythranthe guttata] gi|604344780|gb|EYU43475.1| hypothetical protein MIMGU_mgv1a012049mg [Erythranthe guttata] Length = 263 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 408 KHQGSSKADAEEKFKHCVDAYKSLCNTFSTA 316 KHQ SSKA+AEEKFK CV+AYKSLCNT S A Sbjct: 232 KHQDSSKANAEEKFKDCVNAYKSLCNTLSAA 262