BLASTX nr result
ID: Rehmannia28_contig00018409
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00018409 (317 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094482.1| PREDICTED: probable phytol kinase 1, chlorop... 57 8e-08 ref|XP_011094481.1| PREDICTED: probable phytol kinase 1, chlorop... 57 1e-07 ref|XP_011024295.1| PREDICTED: probable phytol kinase 1, chlorop... 56 3e-07 ref|XP_002315347.2| hypothetical protein POPTR_0010s23890g [Popu... 56 4e-07 emb|CDO99832.1| unnamed protein product [Coffea canephora] 56 5e-07 ref|XP_015387863.1| PREDICTED: probable phytol kinase 1, chlorop... 53 2e-06 ref|XP_015876423.1| PREDICTED: probable phytol kinase 1, chlorop... 54 2e-06 ref|XP_006436583.1| hypothetical protein CICLE_v10032240mg [Citr... 53 4e-06 ref|XP_006436584.1| hypothetical protein CICLE_v10032240mg [Citr... 53 4e-06 gb|AEV40976.1| putative phosphatidate cytidylyltransferase [Oryz... 51 4e-06 ref|XP_006364440.1| PREDICTED: probable phytol kinase 1, chlorop... 52 8e-06 ref|XP_015067787.1| PREDICTED: probable phytol kinase 1, chlorop... 52 8e-06 ref|XP_004234914.1| PREDICTED: probable phytol kinase 1, chlorop... 52 8e-06 gb|AEV41120.1| putative phosphatidate cytidylyltransferase [Oryz... 50 9e-06 gb|AEV41074.1| putative phosphatidate cytidylyltransferase [Oryz... 50 9e-06 >ref|XP_011094482.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X2 [Sesamum indicum] Length = 221 Score = 57.4 bits (137), Expect = 8e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 316 ATVVESLPITGIVDDNITVPLVSMITSFLVFGY 218 AT++ESLP TGIVDDNI+VPL SM+TS LVFGY Sbjct: 189 ATLIESLPTTGIVDDNISVPLASMVTSLLVFGY 221 >ref|XP_011094481.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X1 [Sesamum indicum] Length = 308 Score = 57.4 bits (137), Expect = 1e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 316 ATVVESLPITGIVDDNITVPLVSMITSFLVFGY 218 AT++ESLP TGIVDDNI+VPL SM+TS LVFGY Sbjct: 276 ATLIESLPTTGIVDDNISVPLASMVTSLLVFGY 308 >ref|XP_011024295.1| PREDICTED: probable phytol kinase 1, chloroplastic [Populus euphratica] Length = 307 Score = 56.2 bits (134), Expect = 3e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 316 ATVVESLPITGIVDDNITVPLVSMITSFLVFGY 218 ATVVESLPIT +VDDNITVPLVSM+ S L FGY Sbjct: 275 ATVVESLPITEVVDDNITVPLVSMVVSMLSFGY 307 >ref|XP_002315347.2| hypothetical protein POPTR_0010s23890g [Populus trichocarpa] gi|550330476|gb|EEF01518.2| hypothetical protein POPTR_0010s23890g [Populus trichocarpa] Length = 361 Score = 56.2 bits (134), Expect = 4e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 316 ATVVESLPITGIVDDNITVPLVSMITSFLVFGY 218 ATVVESLPIT +VDDNITVPLVSM+ S L FGY Sbjct: 329 ATVVESLPITEVVDDNITVPLVSMVVSMLSFGY 361 >emb|CDO99832.1| unnamed protein product [Coffea canephora] Length = 326 Score = 55.8 bits (133), Expect = 5e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -2 Query: 316 ATVVESLPITGIVDDNITVPLVSMITSFLVFGY 218 AT+VESLP TGIVDDNI+VP+ SM+T+FL FGY Sbjct: 294 ATLVESLPTTGIVDDNISVPIASMVTAFLSFGY 326 >ref|XP_015387863.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X3 [Citrus sinensis] Length = 189 Score = 53.1 bits (126), Expect = 2e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -2 Query: 316 ATVVESLPITGIVDDNITVPLVSMITSFLVFGY 218 ATVVESLPIT +VDDNI+VPL SM+ ++L FGY Sbjct: 157 ATVVESLPITEVVDDNISVPLASMVAAYLSFGY 189 >ref|XP_015876423.1| PREDICTED: probable phytol kinase 1, chloroplastic [Ziziphus jujuba] Length = 295 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -2 Query: 316 ATVVESLPITGIVDDNITVPLVSMITSFLVFGY 218 AT VESLPIT ++DDNI+VPL SM+T+FL FGY Sbjct: 263 ATFVESLPITKVIDDNISVPLASMVTAFLSFGY 295 >ref|XP_006436583.1| hypothetical protein CICLE_v10032240mg [Citrus clementina] gi|568863637|ref|XP_006485241.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X2 [Citrus sinensis] gi|557538779|gb|ESR49823.1| hypothetical protein CICLE_v10032240mg [Citrus clementina] gi|641836336|gb|KDO55302.1| hypothetical protein CISIN_1g022218mg [Citrus sinensis] Length = 280 Score = 53.1 bits (126), Expect = 4e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -2 Query: 316 ATVVESLPITGIVDDNITVPLVSMITSFLVFGY 218 ATVVESLPIT +VDDNI+VPL SM+ ++L FGY Sbjct: 248 ATVVESLPITEVVDDNISVPLASMVAAYLSFGY 280 >ref|XP_006436584.1| hypothetical protein CICLE_v10032240mg [Citrus clementina] gi|568863635|ref|XP_006485240.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X1 [Citrus sinensis] gi|557538780|gb|ESR49824.1| hypothetical protein CICLE_v10032240mg [Citrus clementina] gi|641836335|gb|KDO55301.1| hypothetical protein CISIN_1g022218mg [Citrus sinensis] Length = 301 Score = 53.1 bits (126), Expect = 4e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -2 Query: 316 ATVVESLPITGIVDDNITVPLVSMITSFLVFGY 218 ATVVESLPIT +VDDNI+VPL SM+ ++L FGY Sbjct: 269 ATVVESLPITEVVDDNISVPLASMVAAYLSFGY 301 >gb|AEV40976.1| putative phosphatidate cytidylyltransferase [Oryza punctata] gi|359359121|gb|AEV41027.1| putative phosphatidate cytidylyltransferase [Oryza minuta] Length = 110 Score = 50.8 bits (120), Expect = 4e-06 Identities = 20/33 (60%), Positives = 29/33 (87%) Frame = -2 Query: 316 ATVVESLPITGIVDDNITVPLVSMITSFLVFGY 218 ATVVE +P+T +VDDNI+VPL +M+ ++L+FGY Sbjct: 74 ATVVECIPVTDVVDDNISVPLATMLAAYLIFGY 106 >ref|XP_006364440.1| PREDICTED: probable phytol kinase 1, chloroplastic [Solanum tuberosum] Length = 316 Score = 52.4 bits (124), Expect = 8e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -2 Query: 316 ATVVESLPITGIVDDNITVPLVSMITSFLVFGY 218 AT+VESLPITG+VDDNI+VPLVSM+ + L F Y Sbjct: 284 ATMVESLPITGMVDDNISVPLVSMVVASLAFAY 316 >ref|XP_015067787.1| PREDICTED: probable phytol kinase 1, chloroplastic [Solanum pennellii] Length = 320 Score = 52.4 bits (124), Expect = 8e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -2 Query: 316 ATVVESLPITGIVDDNITVPLVSMITSFLVFGY 218 AT+VESLPITG+VDDNI+VPLVSM+ + L F Y Sbjct: 288 ATMVESLPITGMVDDNISVPLVSMVVASLAFAY 320 >ref|XP_004234914.1| PREDICTED: probable phytol kinase 1, chloroplastic [Solanum lycopersicum] Length = 320 Score = 52.4 bits (124), Expect = 8e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -2 Query: 316 ATVVESLPITGIVDDNITVPLVSMITSFLVFGY 218 AT+VESLPITG+VDDNI+VPLVSM+ + L F Y Sbjct: 288 ATMVESLPITGMVDDNISVPLVSMVVASLAFAY 320 >gb|AEV41120.1| putative phosphatidate cytidylyltransferase [Oryza officinalis] Length = 110 Score = 50.1 bits (118), Expect = 9e-06 Identities = 20/33 (60%), Positives = 29/33 (87%) Frame = -2 Query: 316 ATVVESLPITGIVDDNITVPLVSMITSFLVFGY 218 ATVVE +P+T +VDDNI+VPL +M+ ++L+FGY Sbjct: 74 ATVVECIPVTDVVDDNISVPLATMLAAYLLFGY 106 >gb|AEV41074.1| putative phosphatidate cytidylyltransferase [Oryza minuta] Length = 110 Score = 50.1 bits (118), Expect = 9e-06 Identities = 20/33 (60%), Positives = 29/33 (87%) Frame = -2 Query: 316 ATVVESLPITGIVDDNITVPLVSMITSFLVFGY 218 ATVVE +P+T +VDDNI+VPL +M+ ++L+FGY Sbjct: 74 ATVVECIPVTDVVDDNISVPLATMLAAYLLFGY 106