BLASTX nr result
ID: Rehmannia28_contig00018380
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00018380 (405 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011085790.1| PREDICTED: paired amphipathic helix protein ... 60 4e-08 ref|XP_011098545.1| PREDICTED: paired amphipathic helix protein ... 59 2e-07 ref|XP_011098544.1| PREDICTED: paired amphipathic helix protein ... 59 2e-07 ref|XP_009760331.1| PREDICTED: paired amphipathic helix protein ... 58 3e-07 ref|XP_009617919.1| PREDICTED: paired amphipathic helix protein ... 58 3e-07 ref|XP_009760271.1| PREDICTED: paired amphipathic helix protein ... 58 3e-07 ref|XP_009617913.1| PREDICTED: paired amphipathic helix protein ... 58 3e-07 ref|XP_009760206.1| PREDICTED: paired amphipathic helix protein ... 58 3e-07 ref|XP_009617907.1| PREDICTED: paired amphipathic helix protein ... 58 3e-07 ref|XP_009760142.1| PREDICTED: paired amphipathic helix protein ... 58 3e-07 ref|XP_009617900.1| PREDICTED: paired amphipathic helix protein ... 58 3e-07 ref|XP_012840651.1| PREDICTED: paired amphipathic helix protein ... 57 4e-07 gb|EYU34690.1| hypothetical protein MIMGU_mgv1a0002562mg, partia... 51 2e-06 gb|EYU29862.1| hypothetical protein MIMGU_mgv1a0002842mg, partia... 55 3e-06 ref|XP_012846353.1| PREDICTED: paired amphipathic helix protein ... 55 3e-06 emb|CDP02173.1| unnamed protein product [Coffea canephora] 54 1e-05 >ref|XP_011085790.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X1 [Sesamum indicum] Length = 1346 Score = 60.5 bits (145), Expect = 4e-08 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 126 MKRLRDEVYMNPQFKRPFGPSSRGESYGLSQAP 28 MKRLRD+VY+NPQFKRPFGPSSR ESYGL P Sbjct: 1 MKRLRDDVYVNPQFKRPFGPSSRVESYGLPNPP 33 >ref|XP_011098545.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X2 [Sesamum indicum] Length = 1379 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/34 (85%), Positives = 29/34 (85%), Gaps = 1/34 (2%) Frame = -1 Query: 126 MKRLRDEVYMNPQFKRPFG-PSSRGESYGLSQAP 28 MKRLRDEVYMNPQFKRPFG SSRGESYG S P Sbjct: 1 MKRLRDEVYMNPQFKRPFGSSSSRGESYGPSHTP 34 >ref|XP_011098544.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X1 [Sesamum indicum] Length = 1380 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/34 (85%), Positives = 29/34 (85%), Gaps = 1/34 (2%) Frame = -1 Query: 126 MKRLRDEVYMNPQFKRPFG-PSSRGESYGLSQAP 28 MKRLRDEVYMNPQFKRPFG SSRGESYG S P Sbjct: 1 MKRLRDEVYMNPQFKRPFGSSSSRGESYGPSHTP 34 >ref|XP_009760331.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X4 [Nicotiana sylvestris] Length = 1285 Score = 57.8 bits (138), Expect = 3e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 126 MKRLRDEVYMNPQFKRPFGPSSRGESYGLSQAP 28 MKRLRD+VY NPQFKRPFG SSRGESYG SQ P Sbjct: 1 MKRLRDDVYANPQFKRPFG-SSRGESYGQSQVP 32 >ref|XP_009617919.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X4 [Nicotiana tomentosiformis] Length = 1285 Score = 57.8 bits (138), Expect = 3e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 126 MKRLRDEVYMNPQFKRPFGPSSRGESYGLSQAP 28 MKRLRD+VY NPQFKRPFG SSRGESYG SQ P Sbjct: 1 MKRLRDDVYANPQFKRPFG-SSRGESYGQSQVP 32 >ref|XP_009760271.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X3 [Nicotiana sylvestris] Length = 1352 Score = 57.8 bits (138), Expect = 3e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 126 MKRLRDEVYMNPQFKRPFGPSSRGESYGLSQAP 28 MKRLRD+VY NPQFKRPFG SSRGESYG SQ P Sbjct: 1 MKRLRDDVYANPQFKRPFG-SSRGESYGQSQVP 32 >ref|XP_009617913.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X3 [Nicotiana tomentosiformis] Length = 1352 Score = 57.8 bits (138), Expect = 3e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 126 MKRLRDEVYMNPQFKRPFGPSSRGESYGLSQAP 28 MKRLRD+VY NPQFKRPFG SSRGESYG SQ P Sbjct: 1 MKRLRDDVYANPQFKRPFG-SSRGESYGQSQVP 32 >ref|XP_009760206.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X2 [Nicotiana sylvestris] Length = 1354 Score = 57.8 bits (138), Expect = 3e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 126 MKRLRDEVYMNPQFKRPFGPSSRGESYGLSQAP 28 MKRLRD+VY NPQFKRPFG SSRGESYG SQ P Sbjct: 1 MKRLRDDVYANPQFKRPFG-SSRGESYGQSQVP 32 >ref|XP_009617907.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X2 [Nicotiana tomentosiformis] Length = 1354 Score = 57.8 bits (138), Expect = 3e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 126 MKRLRDEVYMNPQFKRPFGPSSRGESYGLSQAP 28 MKRLRD+VY NPQFKRPFG SSRGESYG SQ P Sbjct: 1 MKRLRDDVYANPQFKRPFG-SSRGESYGQSQVP 32 >ref|XP_009760142.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X1 [Nicotiana sylvestris] Length = 1358 Score = 57.8 bits (138), Expect = 3e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 126 MKRLRDEVYMNPQFKRPFGPSSRGESYGLSQAP 28 MKRLRD+VY NPQFKRPFG SSRGESYG SQ P Sbjct: 1 MKRLRDDVYANPQFKRPFG-SSRGESYGQSQVP 32 >ref|XP_009617900.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X1 [Nicotiana tomentosiformis] Length = 1358 Score = 57.8 bits (138), Expect = 3e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 126 MKRLRDEVYMNPQFKRPFGPSSRGESYGLSQAP 28 MKRLRD+VY NPQFKRPFG SSRGESYG SQ P Sbjct: 1 MKRLRDDVYANPQFKRPFG-SSRGESYGQSQVP 32 >ref|XP_012840651.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 [Erythranthe guttata] Length = 1349 Score = 57.4 bits (137), Expect = 4e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 126 MKRLRDEVYMNPQFKRPFGPSSRGESYGL 40 MKRLRD+ Y+NPQ KRPFGPSSRGESYGL Sbjct: 1 MKRLRDDAYVNPQTKRPFGPSSRGESYGL 29 >gb|EYU34690.1| hypothetical protein MIMGU_mgv1a0002562mg, partial [Erythranthe guttata] Length = 26 Score = 50.8 bits (120), Expect = 2e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -1 Query: 126 MKRLRDEVYMNPQFKRPFGPSSRGES 49 MKRLRD+ Y+NPQ KRPFGPSSRGES Sbjct: 1 MKRLRDDAYVNPQTKRPFGPSSRGES 26 >gb|EYU29862.1| hypothetical protein MIMGU_mgv1a0002842mg, partial [Erythranthe guttata] gi|604318272|gb|EYU29863.1| hypothetical protein MIMGU_mgv1a0002842mg, partial [Erythranthe guttata] Length = 783 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 126 MKRLRDEVYMNPQFKRPFGPSSRGESYGLSQAP 28 MKRLRDEVYMNPQFKRPF SSR ES+G SQAP Sbjct: 1 MKRLRDEVYMNPQFKRPFTSSSR-ESFGPSQAP 32 >ref|XP_012846353.1| PREDICTED: paired amphipathic helix protein Sin3-like 1 [Erythranthe guttata] Length = 1312 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 126 MKRLRDEVYMNPQFKRPFGPSSRGESYGLSQAP 28 MKRLRDEVYMNPQFKRPF SSR ES+G SQAP Sbjct: 1 MKRLRDEVYMNPQFKRPFTSSSR-ESFGPSQAP 32 >emb|CDP02173.1| unnamed protein product [Coffea canephora] Length = 1370 Score = 53.5 bits (127), Expect = 1e-05 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 126 MKRLRDEVYMNPQFKRPFGPSSRGESYGLSQAP 28 MKRLRD+ ++NPQFKRPFG SSRGESYG Q P Sbjct: 1 MKRLRDDAFVNPQFKRPFG-SSRGESYGQPQVP 32