BLASTX nr result
ID: Rehmannia28_contig00018169
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00018169 (629 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011100079.1| PREDICTED: tRNA(His) guanylyltransferase 1-l... 75 3e-12 >ref|XP_011100079.1| PREDICTED: tRNA(His) guanylyltransferase 1-like [Sesamum indicum] Length = 531 Score = 74.7 bits (182), Expect = 3e-12 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = -2 Query: 622 KIVDNGEGSAGKSRKIVVVKHCNIIETSFWEAHSDILNEKRNGF 491 K+VDN G+AGKSRKIVVVKHCNIIETSFWEAH IL+EK N F Sbjct: 486 KMVDNEGGAAGKSRKIVVVKHCNIIETSFWEAHPGILDEKHNDF 529