BLASTX nr result
ID: Rehmannia28_contig00018050
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00018050 (496 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076201.1| PREDICTED: heat stress transcription factor ... 65 2e-09 >ref|XP_011076201.1| PREDICTED: heat stress transcription factor B-2a-like [Sesamum indicum] gi|747059623|ref|XP_011076202.1| PREDICTED: heat stress transcription factor B-2a-like [Sesamum indicum] Length = 346 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 2 EMDLQLQQPGGDIKSEPLDQDNSGDDQESSWL 97 EMDLQLQQPGGDIKSEPLDQ+NSG DQE+SWL Sbjct: 303 EMDLQLQQPGGDIKSEPLDQENSGTDQETSWL 334