BLASTX nr result
ID: Rehmannia28_contig00018022
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00018022 (414 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097834.1| PREDICTED: grpE protein homolog, mitochondri... 61 2e-08 ref|XP_011097833.1| PREDICTED: grpE protein homolog, mitochondri... 61 2e-08 ref|XP_012841777.1| PREDICTED: grpE protein homolog, mitochondri... 58 2e-07 ref|XP_002277588.2| PREDICTED: grpE protein homolog, mitochondri... 57 5e-07 ref|XP_010644499.1| PREDICTED: grpE protein homolog, mitochondri... 57 5e-07 emb|CAN76715.1| hypothetical protein VITISV_018795 [Vitis vinifera] 57 6e-07 gb|KNA10526.1| hypothetical protein SOVF_143620 [Spinacia oleracea] 55 2e-06 ref|XP_010675797.1| PREDICTED: grpE protein homolog, mitochondri... 54 4e-06 ref|XP_010675796.1| PREDICTED: grpE protein homolog, mitochondri... 54 4e-06 gb|KVH99176.1| GrpE nucleotide exchange factor [Cynara carduncul... 54 7e-06 >ref|XP_011097834.1| PREDICTED: grpE protein homolog, mitochondrial isoform X2 [Sesamum indicum] Length = 324 Score = 61.2 bits (147), Expect = 2e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -2 Query: 413 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE*GSK 303 VAVVLKAGY+LHDR+IRPAEVGVTVAVN +EA GS+ Sbjct: 287 VAVVLKAGYMLHDRVIRPAEVGVTVAVNKDEAGQGSE 323 >ref|XP_011097833.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Sesamum indicum] Length = 352 Score = 61.2 bits (147), Expect = 2e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -2 Query: 413 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE*GSK 303 VAVVLKAGY+LHDR+IRPAEVGVTVAVN +EA GS+ Sbjct: 315 VAVVLKAGYMLHDRVIRPAEVGVTVAVNKDEAGQGSE 351 >ref|XP_012841777.1| PREDICTED: grpE protein homolog, mitochondrial-like [Erythranthe guttata] gi|604328005|gb|EYU33673.1| hypothetical protein MIMGU_mgv1a010831mg [Erythranthe guttata] Length = 300 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -2 Query: 413 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEA 318 V VVLKAGY+LHDR++RPAEVGVTVAV+NEE+ Sbjct: 269 VGVVLKAGYMLHDRVVRPAEVGVTVAVDNEES 300 >ref|XP_002277588.2| PREDICTED: grpE protein homolog, mitochondrial isoform X2 [Vitis vinifera] gi|297737494|emb|CBI26695.3| unnamed protein product [Vitis vinifera] Length = 298 Score = 57.0 bits (136), Expect = 5e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 413 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE 315 VAVVLKAGY+LHDR+IRPAEVGVT AV+N E E Sbjct: 265 VAVVLKAGYMLHDRVIRPAEVGVTQAVDNNETE 297 >ref|XP_010644499.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Vitis vinifera] Length = 324 Score = 57.0 bits (136), Expect = 5e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 413 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE 315 VAVVLKAGY+LHDR+IRPAEVGVT AV+N E E Sbjct: 291 VAVVLKAGYMLHDRVIRPAEVGVTQAVDNNETE 323 >emb|CAN76715.1| hypothetical protein VITISV_018795 [Vitis vinifera] Length = 413 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 413 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE 315 VAVVLKAGY+LHDR+IRPAEVGVT AV+N E E Sbjct: 380 VAVVLKAGYMLHDRVIRPAEVGVTQAVDNNETE 412 >gb|KNA10526.1| hypothetical protein SOVF_143620 [Spinacia oleracea] Length = 300 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 413 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE 315 VAVVLKAGY LHDRIIRPAEVGVT+A+ EA+ Sbjct: 267 VAVVLKAGYTLHDRIIRPAEVGVTIALEKNEAD 299 >ref|XP_010675797.1| PREDICTED: grpE protein homolog, mitochondrial isoform X2 [Beta vulgaris subsp. vulgaris] gi|870861545|gb|KMT12817.1| hypothetical protein BVRB_4g089100 [Beta vulgaris subsp. vulgaris] Length = 309 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 413 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEA 318 VAVVLKAGY LH+RIIRPAEVGVTVA N EA Sbjct: 277 VAVVLKAGYTLHERIIRPAEVGVTVAPENNEA 308 >ref|XP_010675796.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Beta vulgaris subsp. vulgaris] Length = 337 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 413 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEA 318 VAVVLKAGY LH+RIIRPAEVGVTVA N EA Sbjct: 305 VAVVLKAGYTLHERIIRPAEVGVTVAPENNEA 336 >gb|KVH99176.1| GrpE nucleotide exchange factor [Cynara cardunculus var. scolymus] Length = 258 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = -2 Query: 413 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEE 321 VAVVLKAGY+LHDRI+RPAEVGVT+AV+ ++ Sbjct: 224 VAVVLKAGYMLHDRILRPAEVGVTIAVDGDK 254