BLASTX nr result
ID: Rehmannia28_contig00018021
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00018021 (392 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097834.1| PREDICTED: grpE protein homolog, mitochondri... 63 4e-09 ref|XP_011097833.1| PREDICTED: grpE protein homolog, mitochondri... 63 4e-09 ref|XP_012841777.1| PREDICTED: grpE protein homolog, mitochondri... 58 2e-07 ref|XP_002277588.2| PREDICTED: grpE protein homolog, mitochondri... 57 4e-07 ref|XP_010644499.1| PREDICTED: grpE protein homolog, mitochondri... 57 4e-07 emb|CAN76715.1| hypothetical protein VITISV_018795 [Vitis vinifera] 57 4e-07 gb|KNA10526.1| hypothetical protein SOVF_143620 [Spinacia oleracea] 55 2e-06 ref|XP_010675797.1| PREDICTED: grpE protein homolog, mitochondri... 54 3e-06 ref|XP_010060278.1| PREDICTED: grpE protein homolog, mitochondri... 54 4e-06 ref|XP_010675796.1| PREDICTED: grpE protein homolog, mitochondri... 54 4e-06 gb|KVH99176.1| GrpE nucleotide exchange factor [Cynara carduncul... 54 4e-06 ref|XP_015582113.1| PREDICTED: protein GrpE isoform X4 [Ricinus ... 53 9e-06 ref|XP_002531197.1| PREDICTED: protein GrpE isoform X3 [Ricinus ... 53 9e-06 emb|CDP13783.1| unnamed protein product [Coffea canephora] 53 9e-06 gb|KFK45111.1| hypothetical protein AALP_AA1G345900 [Arabis alpina] 49 9e-06 ref|XP_015582112.1| PREDICTED: protein GrpE isoform X2 [Ricinus ... 53 9e-06 ref|XP_015582111.1| PREDICTED: protein GrpE isoform X1 [Ricinus ... 53 9e-06 >ref|XP_011097834.1| PREDICTED: grpE protein homolog, mitochondrial isoform X2 [Sesamum indicum] Length = 324 Score = 62.8 bits (151), Expect = 4e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 2 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE*GSE 112 VAVVLKAGY+LHDR+IRPAEVGVTVAVN +EA GSE Sbjct: 287 VAVVLKAGYMLHDRVIRPAEVGVTVAVNKDEAGQGSE 323 >ref|XP_011097833.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Sesamum indicum] Length = 352 Score = 62.8 bits (151), Expect = 4e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 2 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE*GSE 112 VAVVLKAGY+LHDR+IRPAEVGVTVAVN +EA GSE Sbjct: 315 VAVVLKAGYMLHDRVIRPAEVGVTVAVNKDEAGQGSE 351 >ref|XP_012841777.1| PREDICTED: grpE protein homolog, mitochondrial-like [Erythranthe guttata] gi|604328005|gb|EYU33673.1| hypothetical protein MIMGU_mgv1a010831mg [Erythranthe guttata] Length = 300 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +2 Query: 2 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEA 97 V VVLKAGY+LHDR++RPAEVGVTVAV+NEE+ Sbjct: 269 VGVVLKAGYMLHDRVVRPAEVGVTVAVDNEES 300 >ref|XP_002277588.2| PREDICTED: grpE protein homolog, mitochondrial isoform X2 [Vitis vinifera] gi|297737494|emb|CBI26695.3| unnamed protein product [Vitis vinifera] Length = 298 Score = 57.0 bits (136), Expect = 4e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 2 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE 100 VAVVLKAGY+LHDR+IRPAEVGVT AV+N E E Sbjct: 265 VAVVLKAGYMLHDRVIRPAEVGVTQAVDNNETE 297 >ref|XP_010644499.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Vitis vinifera] Length = 324 Score = 57.0 bits (136), Expect = 4e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 2 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE 100 VAVVLKAGY+LHDR+IRPAEVGVT AV+N E E Sbjct: 291 VAVVLKAGYMLHDRVIRPAEVGVTQAVDNNETE 323 >emb|CAN76715.1| hypothetical protein VITISV_018795 [Vitis vinifera] Length = 413 Score = 57.0 bits (136), Expect = 4e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 2 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE 100 VAVVLKAGY+LHDR+IRPAEVGVT AV+N E E Sbjct: 380 VAVVLKAGYMLHDRVIRPAEVGVTQAVDNNETE 412 >gb|KNA10526.1| hypothetical protein SOVF_143620 [Spinacia oleracea] Length = 300 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 2 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE 100 VAVVLKAGY LHDRIIRPAEVGVT+A+ EA+ Sbjct: 267 VAVVLKAGYTLHDRIIRPAEVGVTIALEKNEAD 299 >ref|XP_010675797.1| PREDICTED: grpE protein homolog, mitochondrial isoform X2 [Beta vulgaris subsp. vulgaris] gi|870861545|gb|KMT12817.1| hypothetical protein BVRB_4g089100 [Beta vulgaris subsp. vulgaris] Length = 309 Score = 54.3 bits (129), Expect = 3e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +2 Query: 2 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEA 97 VAVVLKAGY LH+RIIRPAEVGVTVA N EA Sbjct: 277 VAVVLKAGYTLHERIIRPAEVGVTVAPENNEA 308 >ref|XP_010060278.1| PREDICTED: grpE protein homolog, mitochondrial-like [Eucalyptus grandis] gi|629101435|gb|KCW66904.1| hypothetical protein EUGRSUZ_F00651 [Eucalyptus grandis] Length = 323 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = +2 Query: 2 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE*GSEDRG 121 VAVVLKAGY+L+DR++RPAEVGVT AV N+ E + ++G Sbjct: 283 VAVVLKAGYMLYDRVLRPAEVGVTQAVENDATEANTAEKG 322 >ref|XP_010675796.1| PREDICTED: grpE protein homolog, mitochondrial isoform X1 [Beta vulgaris subsp. vulgaris] Length = 337 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +2 Query: 2 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEA 97 VAVVLKAGY LH+RIIRPAEVGVTVA N EA Sbjct: 305 VAVVLKAGYTLHERIIRPAEVGVTVAPENNEA 336 >gb|KVH99176.1| GrpE nucleotide exchange factor [Cynara cardunculus var. scolymus] Length = 258 Score = 53.9 bits (128), Expect = 4e-06 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 2 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE*GSE 112 VAVVLKAGY+LHDRI+RPAEVGVT+AV+ ++ GSE Sbjct: 224 VAVVLKAGYMLHDRILRPAEVGVTIAVDGDK---GSE 257 >ref|XP_015582113.1| PREDICTED: protein GrpE isoform X4 [Ricinus communis] Length = 303 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 2 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEA 97 VAVVLKAGY+LHDR+IRPAEVGVT V N+ A Sbjct: 269 VAVVLKAGYLLHDRVIRPAEVGVTKEVENDTA 300 >ref|XP_002531197.1| PREDICTED: protein GrpE isoform X3 [Ricinus communis] gi|223529199|gb|EEF31174.1| Protein grpE, putative [Ricinus communis] Length = 308 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 2 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEA 97 VAVVLKAGY+LHDR+IRPAEVGVT V N+ A Sbjct: 274 VAVVLKAGYLLHDRVIRPAEVGVTKEVENDTA 305 >emb|CDP13783.1| unnamed protein product [Coffea canephora] Length = 326 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +2 Query: 2 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE*GSE 112 VAVVLKAGY LHDR+IRPAEVGVT AV N +AE SE Sbjct: 290 VAVVLKAGYTLHDRVIRPAEVGVTRAVEN-DAEQSSE 325 >gb|KFK45111.1| hypothetical protein AALP_AA1G345900 [Arabis alpina] Length = 51 Score = 49.3 bits (116), Expect = 9e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = +2 Query: 2 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEAE*GSE 112 +A VLK GY L DR+IRPAEVGVT AV N+E E SE Sbjct: 14 IAHVLKPGYSLFDRVIRPAEVGVTCAVENQEGEKESE 50 >ref|XP_015582112.1| PREDICTED: protein GrpE isoform X2 [Ricinus communis] Length = 332 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 2 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEA 97 VAVVLKAGY+LHDR+IRPAEVGVT V N+ A Sbjct: 298 VAVVLKAGYLLHDRVIRPAEVGVTKEVENDTA 329 >ref|XP_015582111.1| PREDICTED: protein GrpE isoform X1 [Ricinus communis] Length = 337 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 2 VAVVLKAGYILHDRIIRPAEVGVTVAVNNEEA 97 VAVVLKAGY+LHDR+IRPAEVGVT V N+ A Sbjct: 303 VAVVLKAGYLLHDRVIRPAEVGVTKEVENDTA 334