BLASTX nr result
ID: Rehmannia28_contig00017973
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00017973 (350 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012854076.1| PREDICTED: NADH dehydrogenase [ubiquinone] i... 65 7e-11 ref|XP_011099392.1| PREDICTED: NADH dehydrogenase [ubiquinone] i... 64 1e-10 ref|XP_011099390.1| PREDICTED: NADH dehydrogenase [ubiquinone] i... 64 2e-10 emb|CBI41092.3| unnamed protein product [Vitis vinifera] 60 4e-10 ref|XP_012846658.1| PREDICTED: NADH dehydrogenase [ubiquinone] i... 62 1e-09 emb|CBI38470.3| unnamed protein product [Vitis vinifera] 60 1e-09 ref|XP_002265704.1| PREDICTED: NADH dehydrogenase [ubiquinone] i... 60 3e-09 ref|XP_010647472.1| PREDICTED: NADH dehydrogenase [ubiquinone] i... 60 3e-09 ref|XP_004509060.1| PREDICTED: NADH dehydrogenase [ubiquinone] i... 60 4e-09 ref|XP_006363819.1| PREDICTED: NADH dehydrogenase [ubiquinone] i... 60 6e-09 ref|XP_009626965.1| PREDICTED: NADH dehydrogenase [ubiquinone] i... 59 1e-08 gb|KMZ55972.1| NADH dehydrogenase (Ubiquinone) Fe-S protein 4 [Z... 59 1e-08 gb|KOM32423.1| hypothetical protein LR48_Vigan01g197900 [Vigna a... 59 1e-08 ref|XP_009768701.1| PREDICTED: NADH dehydrogenase [ubiquinone] i... 58 3e-08 ref|XP_004231932.1| PREDICTED: NADH dehydrogenase [ubiquinone] i... 58 3e-08 gb|KRH58130.1| hypothetical protein GLYMA_05G106100 [Glycine max] 56 4e-08 gb|KVH92447.1| NADH dehydrogenase ubiquinone Fe-S protein 4, mit... 59 6e-08 ref|XP_003608534.1| NADH-ubiquinone oxidoreductase 18 kDa subuni... 57 6e-08 gb|KHN20371.1| NADH dehydrogenase [ubiquinone] iron-sulfur prote... 56 1e-07 gb|KHN23251.1| NADH dehydrogenase [ubiquinone] iron-sulfur prote... 56 1e-07 >ref|XP_012854076.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial [Erythranthe guttata] gi|604346007|gb|EYU44504.1| hypothetical protein MIMGU_mgv1a015459mg [Erythranthe guttata] Length = 157 Score = 64.7 bits (156), Expect = 7e-11 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +1 Query: 1 YTVKKHQTPLLKVKSYADNFKWKGPPKTQ 87 YTVKKHQTPLLKVK+YADNFKWKGPPKT+ Sbjct: 127 YTVKKHQTPLLKVKTYADNFKWKGPPKTE 155 >ref|XP_011099392.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial-like [Sesamum indicum] gi|747106610|ref|XP_011101602.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial-like [Sesamum indicum] Length = 157 Score = 63.9 bits (154), Expect = 1e-10 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 1 YTVKKHQTPLLKVKSYADNFKWKGPPKTQ 87 YTVKKHQTPLLKVKSYADNFKWKGPPK + Sbjct: 127 YTVKKHQTPLLKVKSYADNFKWKGPPKAE 155 >ref|XP_011099390.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial-like [Sesamum indicum] Length = 157 Score = 63.5 bits (153), Expect = 2e-10 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 1 YTVKKHQTPLLKVKSYADNFKWKGPPKTQ 87 YTVKKHQTPLLKVKSYADNFKWKGPPK + Sbjct: 127 YTVKKHQTPLLKVKSYADNFKWKGPPKEE 155 >emb|CBI41092.3| unnamed protein product [Vitis vinifera] Length = 66 Score = 60.5 bits (145), Expect = 4e-10 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 YTVKKHQTPLLKVKSYADNFKWKGPPKTQN 90 YTVKK QTPLLK K+YADNFKWKGPPKT++ Sbjct: 37 YTVKKRQTPLLKTKAYADNFKWKGPPKTED 66 >ref|XP_012846658.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial-like isoform X1 [Erythranthe guttata] gi|604317857|gb|EYU29623.1| hypothetical protein MIMGU_mgv1a015582mg [Erythranthe guttata] Length = 152 Score = 61.6 bits (148), Expect = 1e-09 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 1 YTVKKHQTPLLKVKSYADNFKWKGPPKTQ 87 YTVKKH TPLLKVKSYADNFKWKGPPK + Sbjct: 122 YTVKKHHTPLLKVKSYADNFKWKGPPKEE 150 >emb|CBI38470.3| unnamed protein product [Vitis vinifera] Length = 114 Score = 60.5 bits (145), Expect = 1e-09 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 YTVKKHQTPLLKVKSYADNFKWKGPPKTQN 90 YTVKK QTPLLK K+YADNFKWKGPPKT++ Sbjct: 85 YTVKKRQTPLLKTKAYADNFKWKGPPKTED 114 >ref|XP_002265704.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial [Vitis vinifera] gi|731435107|ref|XP_003634841.2| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial-like [Vitis vinifera] gi|147858131|emb|CAN83933.1| hypothetical protein VITISV_035766 [Vitis vinifera] Length = 154 Score = 60.5 bits (145), Expect = 3e-09 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 YTVKKHQTPLLKVKSYADNFKWKGPPKTQN 90 YTVKK QTPLLK K+YADNFKWKGPPKT++ Sbjct: 125 YTVKKRQTPLLKTKAYADNFKWKGPPKTED 154 >ref|XP_010647472.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial-like [Vitis vinifera] Length = 154 Score = 60.5 bits (145), Expect = 3e-09 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 YTVKKHQTPLLKVKSYADNFKWKGPPKTQN 90 YTVKK QTPLLK K+YADNFKWKGPPKT++ Sbjct: 125 YTVKKRQTPLLKTKAYADNFKWKGPPKTED 154 >ref|XP_004509060.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial [Cicer arietinum] Length = 152 Score = 60.1 bits (144), Expect = 4e-09 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 1 YTVKKHQTPLLKVKSYADNFKWKGPPKT 84 Y VKKH TPLLKVK+YADNFKWKGPPKT Sbjct: 122 YVVKKHHTPLLKVKTYADNFKWKGPPKT 149 >ref|XP_006363819.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial [Solanum tuberosum] Length = 156 Score = 59.7 bits (143), Expect = 6e-09 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 1 YTVKKHQTPLLKVKSYADNFKWKGPPKT 84 YTVKK TPLLK+KSYADNFKWKGPPKT Sbjct: 127 YTVKKRHTPLLKIKSYADNFKWKGPPKT 154 >ref|XP_009626965.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial [Nicotiana tomentosiformis] Length = 156 Score = 58.9 bits (141), Expect = 1e-08 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 1 YTVKKHQTPLLKVKSYADNFKWKGPPKTQ 87 YTVKK TPLLK+KSYA+NFKWKGPPKT+ Sbjct: 127 YTVKKRHTPLLKIKSYAENFKWKGPPKTE 155 >gb|KMZ55972.1| NADH dehydrogenase (Ubiquinone) Fe-S protein 4 [Zostera marina] Length = 157 Score = 58.9 bits (141), Expect = 1e-08 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 1 YTVKKHQTPLLKVKSYADNFKWKGPPK 81 YTVKKH TPLLKVK YADNFKWKGPPK Sbjct: 130 YTVKKHNTPLLKVKLYADNFKWKGPPK 156 >gb|KOM32423.1| hypothetical protein LR48_Vigan01g197900 [Vigna angularis] Length = 146 Score = 58.5 bits (140), Expect = 1e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 1 YTVKKHQTPLLKVKSYADNFKWKGPPK 81 Y+VKK QTPLLKVKSYADNFKWKGPPK Sbjct: 116 YSVKKRQTPLLKVKSYADNFKWKGPPK 142 >ref|XP_009768701.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial-like isoform X2 [Nicotiana sylvestris] Length = 156 Score = 57.8 bits (138), Expect = 3e-08 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +1 Query: 1 YTVKKHQTPLLKVKSYADNFKWKGPPKTQ 87 YTV+K TPLLK+KSYA+NFKWKGPPKT+ Sbjct: 127 YTVRKRHTPLLKIKSYAENFKWKGPPKTE 155 >ref|XP_004231932.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial [Solanum lycopersicum] Length = 156 Score = 57.8 bits (138), Expect = 3e-08 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +1 Query: 1 YTVKKHQTPLLKVKSYADNFKWKGPPK 81 YTVKK TPLLK+KSYADNFKWKGPPK Sbjct: 127 YTVKKRHTPLLKIKSYADNFKWKGPPK 153 >gb|KRH58130.1| hypothetical protein GLYMA_05G106100 [Glycine max] Length = 104 Score = 56.2 bits (134), Expect = 4e-08 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +1 Query: 1 YTVKKHQTPLLKVKSYADNFKWKGPPKT 84 Y+VKK TPLLKVKSYADNFKWKGPPK+ Sbjct: 74 YSVKKPHTPLLKVKSYADNFKWKGPPKS 101 >gb|KVH92447.1| NADH dehydrogenase ubiquinone Fe-S protein 4, mitochondrial [Cynara cardunculus var. scolymus] Length = 380 Score = 58.9 bits (141), Expect = 6e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 1 YTVKKHQTPLLKVKSYADNFKWKGPPKT 84 YTVKKHQTPLLKVK+Y+DNFKWKG PKT Sbjct: 350 YTVKKHQTPLLKVKAYSDNFKWKGLPKT 377 >ref|XP_003608534.1| NADH-ubiquinone oxidoreductase 18 kDa subunit [Medicago truncatula] gi|355509589|gb|AES90731.1| NADH-ubiquinone oxidoreductase 18 kDa subunit [Medicago truncatula] gi|388507618|gb|AFK41875.1| unknown [Medicago truncatula] Length = 154 Score = 57.0 bits (136), Expect = 6e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +1 Query: 1 YTVKKHQTPLLKVKSYADNFKWKGPPK 81 Y VKKH TPLLKVK YADNFKWKGPPK Sbjct: 122 YVVKKHHTPLLKVKLYADNFKWKGPPK 148 >gb|KHN20371.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial [Glycine soja] Length = 143 Score = 56.2 bits (134), Expect = 1e-07 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +1 Query: 1 YTVKKHQTPLLKVKSYADNFKWKGPPKT 84 Y+VKK TPLLKVKSYADNFKWKGPPK+ Sbjct: 113 YSVKKPHTPLLKVKSYADNFKWKGPPKS 140 >gb|KHN23251.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial [Glycine soja] gi|947054960|gb|KRH04413.1| hypothetical protein GLYMA_17G160400 [Glycine max] Length = 146 Score = 56.2 bits (134), Expect = 1e-07 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +1 Query: 1 YTVKKHQTPLLKVKSYADNFKWKGPPKT 84 Y+VKK TPLLKVKSYADNFKWKGPPK+ Sbjct: 116 YSVKKPHTPLLKVKSYADNFKWKGPPKS 143