BLASTX nr result
ID: Rehmannia28_contig00017744
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00017744 (544 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012829544.1| PREDICTED: pentatricopeptide repeat-containi... 59 4e-07 ref|XP_011101111.1| PREDICTED: pentatricopeptide repeat-containi... 59 4e-07 ref|XP_004244963.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_015085397.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 gb|KDO85079.1| hypothetical protein CISIN_1g0057291mg, partial [... 54 3e-06 ref|XP_011041249.1| PREDICTED: pentatricopeptide repeat-containi... 55 7e-06 ref|XP_002306972.1| hypothetical protein POPTR_0005s27160g [Popu... 55 7e-06 ref|XP_009336548.1| PREDICTED: pentatricopeptide repeat-containi... 55 7e-06 ref|XP_008347337.1| PREDICTED: pentatricopeptide repeat-containi... 55 9e-06 ref|XP_004500883.1| PREDICTED: pentatricopeptide repeat-containi... 55 9e-06 ref|XP_006346695.1| PREDICTED: pentatricopeptide repeat-containi... 55 9e-06 ref|XP_008377072.1| PREDICTED: pentatricopeptide repeat-containi... 55 9e-06 gb|KCW70313.1| hypothetical protein EUGRSUZ_F03554 [Eucalyptus g... 52 1e-05 >ref|XP_012829544.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Erythranthe guttata] gi|604297234|gb|EYU17498.1| hypothetical protein MIMGU_mgv1a002335mg [Erythranthe guttata] Length = 687 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 2 EMLLSGCAPDRKARAMLRSALKYMKSTLRL 91 EMLLSGCAPDRKARAMLRSAL+YMKSTL+L Sbjct: 658 EMLLSGCAPDRKARAMLRSALRYMKSTLKL 687 >ref|XP_011101111.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Sesamum indicum] Length = 689 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 2 EMLLSGCAPDRKARAMLRSALKYMKSTLRL 91 EMLLSGCAPDRKARAMLRSAL+YMKSTL+L Sbjct: 660 EMLLSGCAPDRKARAMLRSALRYMKSTLKL 689 >ref|XP_004244963.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Solanum lycopersicum] Length = 699 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 2 EMLLSGCAPDRKARAMLRSALKYMKSTLRL 91 EMLLSGC PDRKARAMLRSAL+YMKSTL+L Sbjct: 670 EMLLSGCIPDRKARAMLRSALRYMKSTLKL 699 >ref|XP_015085397.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Solanum pennellii] Length = 700 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 2 EMLLSGCAPDRKARAMLRSALKYMKSTLRL 91 EMLLSGC PDRKARAMLRSAL+YMKSTL+L Sbjct: 671 EMLLSGCIPDRKARAMLRSALRYMKSTLKL 700 >gb|KDO85079.1| hypothetical protein CISIN_1g0057291mg, partial [Citrus sinensis] Length = 111 Score = 53.5 bits (127), Expect = 3e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +2 Query: 2 EMLLSGCAPDRKARAMLRSALKYMKSTLR 88 EM+LSGC PDRKARAMLRSAL+YMK TL+ Sbjct: 82 EMILSGCTPDRKARAMLRSALRYMKQTLK 110 >ref|XP_011041249.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Populus euphratica] Length = 701 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +2 Query: 2 EMLLSGCAPDRKARAMLRSALKYMKSTLRL 91 EM+LSGC PDRKARAMLRSALKYMK TL L Sbjct: 672 EMILSGCTPDRKARAMLRSALKYMKQTLEL 701 >ref|XP_002306972.1| hypothetical protein POPTR_0005s27160g [Populus trichocarpa] gi|222856421|gb|EEE93968.1| hypothetical protein POPTR_0005s27160g [Populus trichocarpa] Length = 709 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +2 Query: 2 EMLLSGCAPDRKARAMLRSALKYMKSTLRL 91 EM+LSGC PDRKARAMLRSALKYMK TL L Sbjct: 680 EMILSGCTPDRKARAMLRSALKYMKQTLEL 709 >ref|XP_009336548.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Pyrus x bretschneideri] Length = 378 Score = 55.1 bits (131), Expect = 7e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +2 Query: 2 EMLLSGCAPDRKARAMLRSALKYMKSTLR 88 EM++SGC PDRKARAMLRSALKYMK TLR Sbjct: 349 EMIMSGCTPDRKARAMLRSALKYMKQTLR 377 >ref|XP_008347337.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like, partial [Malus domestica] Length = 597 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +2 Query: 2 EMLLSGCAPDRKARAMLRSALKYMKSTLR 88 EM++SGC PDRKARAMLRSALKYMK TLR Sbjct: 568 EMIMSGCTPDRKARAMLRSALKYMKQTLR 596 >ref|XP_004500883.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Cicer arietinum] Length = 691 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +2 Query: 2 EMLLSGCAPDRKARAMLRSALKYMKSTLR 88 EM++SGCAPDRKARAMLRSAL+YMK TLR Sbjct: 662 EMVMSGCAPDRKARAMLRSALRYMKQTLR 690 >ref|XP_006346695.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial isoform X1 [Solanum tuberosum] Length = 697 Score = 55.1 bits (131), Expect = 9e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 EMLLSGCAPDRKARAMLRSALKYMKSTLRL 91 EMLL GC PDRKARAMLRSAL+YMKSTL+L Sbjct: 668 EMLLCGCIPDRKARAMLRSALRYMKSTLKL 697 >ref|XP_008377072.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Malus domestica] Length = 721 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +2 Query: 2 EMLLSGCAPDRKARAMLRSALKYMKSTLR 88 EM++SGC PDRKARAMLRSALKYMK TLR Sbjct: 692 EMIMSGCTPDRKARAMLRSALKYMKQTLR 720 >gb|KCW70313.1| hypothetical protein EUGRSUZ_F03554 [Eucalyptus grandis] Length = 111 Score = 52.0 bits (123), Expect = 1e-05 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +2 Query: 2 EMLLSGCAPDRKARAMLRSALKYMKSTLR 88 EM++SGC PDRKARAMLRSAL+YM+ TLR Sbjct: 81 EMIVSGCMPDRKARAMLRSALRYMRQTLR 109