BLASTX nr result
ID: Rehmannia28_contig00017357
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00017357 (538 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076010.1| PREDICTED: glutamate synthase 1 [NADH], chlo... 56 4e-06 ref|XP_011076008.1| PREDICTED: glutamate synthase 1 [NADH], chlo... 56 4e-06 >ref|XP_011076010.1| PREDICTED: glutamate synthase 1 [NADH], chloroplastic isoform X3 [Sesamum indicum] Length = 1890 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -3 Query: 536 SEGRQAAAQVDKYLVKDEDDPSLITEEQDDFVRRQQDSNRHRVMT 402 SEGRQAAAQVDKYL D ++ +E ++FV+RQQDSNR RVMT Sbjct: 1850 SEGRQAAAQVDKYL----SDATVASEGDEEFVKRQQDSNRQRVMT 1890 >ref|XP_011076008.1| PREDICTED: glutamate synthase 1 [NADH], chloroplastic isoform X1 [Sesamum indicum] Length = 2215 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -3 Query: 536 SEGRQAAAQVDKYLVKDEDDPSLITEEQDDFVRRQQDSNRHRVMT 402 SEGRQAAAQVDKYL D ++ +E ++FV+RQQDSNR RVMT Sbjct: 2175 SEGRQAAAQVDKYL----SDATVASEGDEEFVKRQQDSNRQRVMT 2215