BLASTX nr result
ID: Rehmannia28_contig00017303
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00017303 (354 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072164.1| PREDICTED: 60S ribosomal protein L23-like [S... 42 8e-08 >ref|XP_011072164.1| PREDICTED: 60S ribosomal protein L23-like [Sesamum indicum] Length = 211 Score = 42.4 bits (98), Expect(2) = 8e-08 Identities = 24/48 (50%), Positives = 28/48 (58%) Frame = -3 Query: 277 YIFALVSVIRVF*LNYLYLREMKAVFISGIFVRAKVFCCLDSTNYCFY 134 YIF L S IR F L + +M AV GIFVRAK F +DS YC + Sbjct: 140 YIFVLASSIRSFKL--FFFSKMNAVIFHGIFVRAKNFSEVDSFKYCIF 185 Score = 40.8 bits (94), Expect(2) = 8e-08 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -2 Query: 353 KECADLWPRIASAANAIV 300 KECADLWPRIASAANAIV Sbjct: 115 KECADLWPRIASAANAIV 132