BLASTX nr result
ID: Rehmannia28_contig00017220
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00017220 (375 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011091135.1| PREDICTED: uncharacterized protein LOC105171... 66 2e-10 gb|EYU32995.1| hypothetical protein MIMGU_mgv1a004476mg [Erythra... 60 3e-08 ref|XP_012842682.1| PREDICTED: uncharacterized protein LOC105962... 60 3e-08 >ref|XP_011091135.1| PREDICTED: uncharacterized protein LOC105171650 [Sesamum indicum] Length = 483 Score = 66.2 bits (160), Expect = 2e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +2 Query: 2 NQVYEPGSVWNDIVLLSTRTSLQLELKTVVKKIEVPVA 115 +Q++EPGSVWND+VLLSTR SLQLELKT V KIE+PVA Sbjct: 446 DQIHEPGSVWNDVVLLSTRASLQLELKTAVMKIEIPVA 483 >gb|EYU32995.1| hypothetical protein MIMGU_mgv1a004476mg [Erythranthe guttata] Length = 496 Score = 60.1 bits (144), Expect = 3e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 2 NQVYEPGSVWNDIVLLSTRTSLQLELKTVVKKIEVPV 112 +++ EPGSVW D+VLL TR+SLQLELK VVKKIEVPV Sbjct: 458 DRINEPGSVWKDVVLLPTRSSLQLELKNVVKKIEVPV 494 >ref|XP_012842682.1| PREDICTED: uncharacterized protein LOC105962889 [Erythranthe guttata] gi|604327045|gb|EYU32994.1| hypothetical protein MIMGU_mgv1a004476mg [Erythranthe guttata] Length = 525 Score = 60.1 bits (144), Expect = 3e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 2 NQVYEPGSVWNDIVLLSTRTSLQLELKTVVKKIEVPV 112 +++ EPGSVW D+VLL TR+SLQLELK VVKKIEVPV Sbjct: 487 DRINEPGSVWKDVVLLPTRSSLQLELKNVVKKIEVPV 523