BLASTX nr result
ID: Rehmannia28_contig00017082
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00017082 (445 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012842036.1| PREDICTED: peroxisome biogenesis protein 19-... 54 4e-06 ref|XP_011070126.1| PREDICTED: peroxisome biogenesis protein 19-... 54 9e-06 >ref|XP_012842036.1| PREDICTED: peroxisome biogenesis protein 19-2-like [Erythranthe guttata] Length = 251 Score = 54.3 bits (129), Expect = 4e-06 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -1 Query: 118 FQNLNLASSARRGLDNNSDNPGESKKESSTLTSGNVQGL 2 FQ+LNL SSARRGLD NSDN K+ESSTL SG+VQGL Sbjct: 17 FQSLNLTSSARRGLDKNSDN----KQESSTLVSGSVQGL 51 >ref|XP_011070126.1| PREDICTED: peroxisome biogenesis protein 19-2-like [Sesamum indicum] Length = 257 Score = 53.5 bits (127), Expect = 9e-06 Identities = 27/40 (67%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = -1 Query: 118 FQNLNLASSARRGLDNNSDNPGESKKE-SSTLTSGNVQGL 2 FQ+LNL +SA+ G+DNN PGESK+E SSTL GNVQGL Sbjct: 19 FQSLNLTASAQSGVDNNCQKPGESKQESSSTLACGNVQGL 58