BLASTX nr result
ID: Rehmannia28_contig00017062
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00017062 (346 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086263.1| PREDICTED: SNF1-related protein kinase regul... 67 5e-11 >ref|XP_011086263.1| PREDICTED: SNF1-related protein kinase regulatory subunit beta-2-like [Sesamum indicum] Length = 288 Score = 67.0 bits (162), Expect = 5e-11 Identities = 37/63 (58%), Positives = 38/63 (60%), Gaps = 6/63 (9%) Frame = +2 Query: 176 MGNANGREEGGGDSPSEAEEGGGAQVSMADRDG------ALGGEYMGXXXXXXXXXXXXX 337 MGNANGRE+GG SPS EEGGG QVSMADRDG A GGEYMG Sbjct: 1 MGNANGREDGGSGSPSGVEEGGGGQVSMADRDGGAGNYAADGGEYMGQSPLPSPRASQSP 60 Query: 338 LMF 346 LMF Sbjct: 61 LMF 63