BLASTX nr result
ID: Rehmannia28_contig00016787
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00016787 (378 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077262.1| PREDICTED: uncharacterized protein LOC105161... 78 2e-14 ref|XP_012834753.1| PREDICTED: uncharacterized protein LOC105955... 73 9e-13 ref|XP_009775880.1| PREDICTED: uncharacterized protein LOC104225... 54 7e-06 >ref|XP_011077262.1| PREDICTED: uncharacterized protein LOC105161315 [Sesamum indicum] Length = 722 Score = 77.8 bits (190), Expect = 2e-14 Identities = 35/39 (89%), Positives = 35/39 (89%) Frame = +1 Query: 262 MGSKWRKVKLAFGLNLCVYGPKNLVADNDDDEDSLPPSE 378 MGSKWRKVKLA GLNLCVYGP N V DNDDDEDSLPPSE Sbjct: 1 MGSKWRKVKLALGLNLCVYGPNNHVVDNDDDEDSLPPSE 39 >ref|XP_012834753.1| PREDICTED: uncharacterized protein LOC105955551 [Erythranthe guttata] Length = 694 Score = 73.2 bits (178), Expect = 9e-13 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +1 Query: 262 MGSKWRKVKLAFGLNLCVYGPKNLVADNDDDEDSLPP 372 MGSKWRKVKLA G+NLCVYGP+N VADNDDD DSLPP Sbjct: 1 MGSKWRKVKLALGMNLCVYGPRNHVADNDDDYDSLPP 37 >ref|XP_009775880.1| PREDICTED: uncharacterized protein LOC104225719 [Nicotiana sylvestris] Length = 724 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +1 Query: 262 MGSKWRKVKLAFGLNLCVYGPKNLVADNDDDEDSLP 369 MGSKW KVKLA GLNLC Y P+ L DNDD++DS P Sbjct: 1 MGSKWAKVKLALGLNLCTYIPRTL--DNDDEDDSSP 34