BLASTX nr result
ID: Rehmannia28_contig00016755
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00016755 (374 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086030.1| PREDICTED: transcription factor VOZ1-like is... 82 4e-16 ref|XP_011086029.1| PREDICTED: transcription factor VOZ1-like is... 82 5e-16 ref|XP_011086027.1| PREDICTED: transcription factor VOZ1-like is... 82 5e-16 ref|XP_011096373.1| PREDICTED: transcription factor VOZ1 [Sesamu... 74 4e-13 emb|CDO99464.1| unnamed protein product [Coffea canephora] 56 7e-07 emb|CDO96711.1| unnamed protein product [Coffea canephora] 54 4e-06 >ref|XP_011086030.1| PREDICTED: transcription factor VOZ1-like isoform X3 [Sesamum indicum] Length = 438 Score = 82.4 bits (202), Expect = 4e-16 Identities = 38/43 (88%), Positives = 39/43 (90%) Frame = -3 Query: 372 LKDGNGSIYPASNALASPGEGLDYVRGAPYDYLVDNINGYYLT 244 +KDG GSIY ASNALASPGEG DYVRGAPYDYLV NINGYYLT Sbjct: 396 MKDGMGSIYSASNALASPGEGFDYVRGAPYDYLVGNINGYYLT 438 >ref|XP_011086029.1| PREDICTED: transcription factor VOZ1-like isoform X2 [Sesamum indicum] Length = 477 Score = 82.4 bits (202), Expect = 5e-16 Identities = 38/43 (88%), Positives = 39/43 (90%) Frame = -3 Query: 372 LKDGNGSIYPASNALASPGEGLDYVRGAPYDYLVDNINGYYLT 244 +KDG GSIY ASNALASPGEG DYVRGAPYDYLV NINGYYLT Sbjct: 435 MKDGMGSIYSASNALASPGEGFDYVRGAPYDYLVGNINGYYLT 477 >ref|XP_011086027.1| PREDICTED: transcription factor VOZ1-like isoform X1 [Sesamum indicum] gi|747077776|ref|XP_011086028.1| PREDICTED: transcription factor VOZ1-like isoform X1 [Sesamum indicum] Length = 486 Score = 82.4 bits (202), Expect = 5e-16 Identities = 38/43 (88%), Positives = 39/43 (90%) Frame = -3 Query: 372 LKDGNGSIYPASNALASPGEGLDYVRGAPYDYLVDNINGYYLT 244 +KDG GSIY ASNALASPGEG DYVRGAPYDYLV NINGYYLT Sbjct: 444 MKDGMGSIYSASNALASPGEGFDYVRGAPYDYLVGNINGYYLT 486 >ref|XP_011096373.1| PREDICTED: transcription factor VOZ1 [Sesamum indicum] Length = 454 Score = 73.9 bits (180), Expect = 4e-13 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -3 Query: 372 LKDGNGSIYPASNALASPGEGLDYVRGAPYDYLVDNINGYYLT 244 LKDG G+IY ASNAL SP EG DY RGAPYDYLVD+I+ YYLT Sbjct: 412 LKDGTGNIYSASNALGSPAEGFDYARGAPYDYLVDDISAYYLT 454 >emb|CDO99464.1| unnamed protein product [Coffea canephora] Length = 485 Score = 56.2 bits (134), Expect = 7e-07 Identities = 24/42 (57%), Positives = 29/42 (69%) Frame = -3 Query: 369 KDGNGSIYPASNALASPGEGLDYVRGAPYDYLVDNINGYYLT 244 KD GSIY N + GEG +Y GA Y+YLVDN+NGYY+T Sbjct: 444 KDAAGSIYSTPNRMPPTGEGFEYSTGASYEYLVDNLNGYYVT 485 >emb|CDO96711.1| unnamed protein product [Coffea canephora] Length = 354 Score = 53.9 bits (128), Expect = 4e-06 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = -3 Query: 369 KDGNGSIYPASNALASPGEGLDYVRGAPYDYLVDNINGYY 250 KD GSIY N + GEG +Y GA Y+YLVDN+NGYY Sbjct: 292 KDAAGSIYSTPNRMPPTGEGFEYSTGASYEYLVDNLNGYY 331