BLASTX nr result
ID: Rehmannia28_contig00016578
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00016578 (542 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010094359.1| hypothetical protein L484_002946 [Morus nota... 64 3e-09 ref|XP_010093830.1| hypothetical protein L484_022544 [Morus nota... 60 3e-08 >ref|XP_010094359.1| hypothetical protein L484_002946 [Morus notabilis] gi|587866404|gb|EXB55870.1| hypothetical protein L484_002946 [Morus notabilis] Length = 252 Score = 63.9 bits (154), Expect = 3e-09 Identities = 28/69 (40%), Positives = 45/69 (65%), Gaps = 1/69 (1%) Frame = -2 Query: 208 VQKVIDARMHKAWKGYRFKLHKYFKEIGGEKDPIVAKNKCHKDVR-QENWEYLCDLWIDS 32 V K ID +M+K W+ +R++LH +++ +GG+ DP K KC K +R Q +WEYLC+ W Sbjct: 66 VLKSIDRQMNKLWRDFRYELHCHWELMGGKIDPEAVKQKCPKRIRSQADWEYLCNYWSSE 125 Query: 31 KYLDKAQKN 5 + ++KN Sbjct: 126 QLQKISEKN 134 >ref|XP_010093830.1| hypothetical protein L484_022544 [Morus notabilis] gi|587865102|gb|EXB54681.1| hypothetical protein L484_022544 [Morus notabilis] Length = 162 Score = 59.7 bits (143), Expect = 3e-08 Identities = 27/71 (38%), Positives = 46/71 (64%), Gaps = 1/71 (1%) Frame = -2 Query: 211 NVQKVIDARMHKAWKGYRFKLHKYFKEIGGEKDPIVAKNKCHKD-VRQENWEYLCDLWID 35 +++KVID +M + + +R L KYFK+IGGE P +AK D + E+WE+LCD W Sbjct: 58 DIKKVIDDQMKDSHRSWRCSLRKYFKKIGGEISPEIAKRLPPDDIINYEDWEWLCDYWST 117 Query: 34 SKYLDKAQKNV 2 + ++ +++N+ Sbjct: 118 EEQVELSKQNM 128